XB-FEAT-22166507: Difference between revisions
(6 intermediate revisions by the same user not shown) | |||
Line 1: | Line 1: | ||
='' | =''hepacam2l''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''hepacam2l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=nomenclature changes= | =nomenclature changes= | ||
11.30.2020. | 11.30.2020. | ||
This gene 's name was corrected by removing human loci number from the gene name and gene symbol, following notification of the issue by NCBIs refseq coordinator (RSCOM-106). | This gene 's name was corrected by removing human loci number from the gene name and gene symbol, following notification of the issue by NCBIs refseq coordinator (RSCOM-106). | ||
Line 11: | Line 12: | ||
Symbol changed from ''ig100492381'' to ''XB22166507 [provisonal]'' | Symbol changed from ''ig100492381'' to ''XB22166507 [provisonal]'' | ||
25April2023 | 25April2023 | ||
based on DIOPT/homology group analysis of protein by Xenbase curation team: | based on DIOPT/homology group analysis of protein by Xenbase curation team: | ||
Symbol changed from ''XB22166507 [ | Symbol changed from ''XB22166507 [provisional]'' to ''hepacam2l'' | ||
Gene name changed from 'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2' | Gene name changed from 'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2 like' | ||
=homology of | =homology of ''X. tropicalis'' protein= | ||
uncharacterized protein ig100492381 [Xenopus tropicalis] | uncharacterized protein ig100492381 [Xenopus tropicalis] | ||
Line 25: | Line 28: | ||
>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis] | >XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis] | ||
MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVRCTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDKSSASATINVTVEDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLGMETKPPRRNMIRKYYGPTWIQ | |||
DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including X. tropicalis accession 8364.ENSXETP00000030379 | |||
=synteny and orthology= | |||
The ''Xenopus'' ''hepacam2'' gene which is considered the true ortholog of Human HEPACAM2, based on conserved synteny and protein architecture, is found on Chr6/6l/6S in ''Xenopus'' | |||
Synteny pattern: | |||
''Xenopus'' chr6/6L/6S: samd9l .. '''hepacam2''' ... vps50... Loc# ..LOC# ... calcr | |||
human: SAMD9L ... '''HEPACAM2''' ...VPS50 ....// | |||
This second 'hepacam2' '''like''' gene is found in ''Xenopus'' on chromosomes 1/1L/1S, and it is therefore '''NOT''' the true ortholog of the human HEPACAM2. | |||
''Xenopus'' Chr1/1L/1S: adissp> ... hspa12b< ... lyrm2< ... '''hepacam2l'''< ... gpr151 ... rnf145l |
Latest revision as of 09:13, 25 April 2023
hepacam2l
This is the community wiki page for the gene hepacam2l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
11.30.2020.
This gene 's name was corrected by removing human loci number from the gene name and gene symbol, following notification of the issue by NCBIs refseq coordinator (RSCOM-106).
Name changed from: uncharacterized protein containing Ig superfamily v domain 100492381 [provisional] to uncharacterized protein containing Ig superfamily v domain [provisional]
Symbol changed from ig100492381 to XB22166507 [provisonal]
25April2023
based on DIOPT/homology group analysis of protein by Xenbase curation team:
Symbol changed from XB22166507 [provisional] to hepacam2l
Gene name changed from 'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2 like'
homology of X. tropicalis protein
uncharacterized protein ig100492381 [Xenopus tropicalis]
NCBI Reference Sequence: XP_002936341.1
>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis] MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVRCTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDKSSASATINVTVEDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLGMETKPPRRNMIRKYYGPTWIQ
DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including X. tropicalis accession 8364.ENSXETP00000030379
synteny and orthology
The Xenopus hepacam2 gene which is considered the true ortholog of Human HEPACAM2, based on conserved synteny and protein architecture, is found on Chr6/6l/6S in Xenopus
Synteny pattern:
Xenopus chr6/6L/6S: samd9l .. hepacam2 ... vps50... Loc# ..LOC# ... calcr
human: SAMD9L ... HEPACAM2 ...VPS50 ....//
This second 'hepacam2' like gene is found in Xenopus on chromosomes 1/1L/1S, and it is therefore NOT the true ortholog of the human HEPACAM2.
Xenopus Chr1/1L/1S: adissp> ... hspa12b< ... lyrm2< ... hepacam2l< ... gpr151 ... rnf145l