XB-FEAT-952622: Difference between revisions
imported>Xenbase gene generator No edit summary |
|||
(One intermediate revision by one other user not shown) | |||
Line 1: | Line 1: | ||
= | =''tex49''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''tex49'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | ||
=nomenclature changes= | |||
25April2023 | |||
The name of this gene was changed to tex49, testis-expressed protein 49 following review of orthology and synteny. | |||
=protein= | |||
testis-expressed protein 49 [Xenopus tropicalis] | |||
NCBI Reference Sequence: XP_002935150.2 | |||
>XP_002935150.2 testis-expressed protein 49 [Xenopus tropicalis] | |||
MAFFGLTHLGYQDPLRALSLQGNGQAAASGQTAVYGKHEESHIKLPALVPQSPYVSHGKYQEMRRRHQDL | |||
RTPKQTQRMPATSAQQYGWWLPQDPRSKAESVHPWIGCQRYPQISSPMTLFVQQMYLTDKSFRLF | |||
This protein is identical to 39 proteins/species tex49 genes, according to a DIOPT/EggNog analysis which aligns proteins to pre-calculated homology groups, supporting the above gene nomenclature change. |
Latest revision as of 08:18, 26 April 2023
tex49
This is the community wiki page for the gene tex49 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
nomenclature changes
25April2023
The name of this gene was changed to tex49, testis-expressed protein 49 following review of orthology and synteny.
protein
testis-expressed protein 49 [Xenopus tropicalis] NCBI Reference Sequence: XP_002935150.2
>XP_002935150.2 testis-expressed protein 49 [Xenopus tropicalis] MAFFGLTHLGYQDPLRALSLQGNGQAAASGQTAVYGKHEESHIKLPALVPQSPYVSHGKYQEMRRRHQDL RTPKQTQRMPATSAQQYGWWLPQDPRSKAESVHPWIGCQRYPQISSPMTLFVQQMYLTDKSFRLF
This protein is identical to 39 proteins/species tex49 genes, according to a DIOPT/EggNog analysis which aligns proteins to pre-calculated homology groups, supporting the above gene nomenclature change.