XB-FEAT-5934217: Difference between revisions
Jump to navigation
Jump to search
| (3 intermediate revisions by the same user not shown) | |||
| Line 1: | Line 1: | ||
='' | =''fdx1l.2''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''fdx1l.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=orthology/homology analysis= | =orthology/homology analysis= | ||
DIOPT/EggNog identifies this protein as a Ferredoxin with very high certainty, matching | DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching | ||
=protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L | =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485 | ||
>XP_002936827.1 adrenodoxin [Xenopus tropicalis] | |||
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET | |||
LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS | |||
RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ | |||
=nomenclature changes= | =nomenclature changes= | ||
Based on above analysis, gene symbol updated, changing from ''fdx1b'' to '' | Based on above analysis, gene symbol updated, changing from ''fdx1b'' to ''fdx1l.2, feradoxin 1 like gene 2'' | ||
Latest revision as of 10:32, 26 April 2023
fdx1l.2
This is the community wiki page for the gene fdx1l.2 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
orthology/homology analysis
DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485
>XP_002936827.1 adrenodoxin [Xenopus tropicalis]
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ
nomenclature changes
Based on above analysis, gene symbol updated, changing from fdx1b to fdx1l.2, feradoxin 1 like gene 2