XB-FEAT-22164552: Difference between revisions
(Created page with " =''csta''= This is the community wiki page for the gene ''csta'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...") |
(→cstb) |
||
| Line 1: | Line 1: | ||
='' | =''cstb''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''cstb'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=protein sequence= | =protein sequence= | ||
Revision as of 14:17, 4 January 2023
cstb
This is the community wiki page for the gene cstb please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
protein sequence
MEGICGGTGAQKVADAEVQEICDKVKAEFLEKSGVNTSLFKAVSYKTQQVAGTNYFIKVNIGDDKCVHIRVYRIVGEQMEALRFDSFLLD KTMEEEIVYF
this protein has a Cystatin-like domain, and is predicted to have cysteine-type endopeptidase inhibitor activity.
The DIOPT EggNogg tool groups it with CSTA CSTB and STFA2 gene from Mouse, Rat and 120 other species, and cst14a.1, zgc:153129, zgc:56530 in Danio Rerio (Zebrafish). This is good eveidence it is a cystantin, but cannot tell if it shoudl be cystatin A or cystatin B
nomenclature changes
based on above quick analysis, this gene is provisonaly renamed cystain A, with gene symbol csta