User contributions for Christina
Jump to navigation
Jump to search
5 July 2023
- 08:1808:18, 5 July 2023 diff hist +2 XB-FEAT-22065331 →nomenclature changes current
- 08:1708:17, 5 July 2023 diff hist +80 XB-FEAT-22065331 →nomenclature changes
- 07:4307:43, 5 July 2023 diff hist +209 XB-FEAT-493800 →larp6 current
1 July 2023
- 14:5814:58, 1 July 2023 diff hist −6 XB-FEAT-13579844 →c1h4orf48 current
30 June 2023
- 14:4014:40, 30 June 2023 diff hist +426 XB-FEAT-13579844 →nomenclature changes
- 14:2314:23, 30 June 2023 diff hist +180 XB-FEAT-5767696 →fam120a current
- 14:2114:21, 30 June 2023 diff hist +157 XB-FEAT-6037326 →fam120c current
- 14:1114:11, 30 June 2023 diff hist +180 XB-FEAT-980081 →fam120b current
- 14:0914:09, 30 June 2023 diff hist +176 XB-FEAT-494052 →tubgcp5 current
- 14:0314:03, 30 June 2023 diff hist +175 XB-FEAT-491695 →tubgcp4 current
- 13:5713:57, 30 June 2023 diff hist +174 XB-FEAT-490982 →tubgcp3 current
- 13:5113:51, 30 June 2023 diff hist +175 XB-FEAT-490605 →tubgcp6 current
- 13:4913:49, 30 June 2023 diff hist +168 XB-FEAT-490452 →tubgcp2 current
- 12:2912:29, 30 June 2023 diff hist +307 XB-FEAT-995201 →loc100158538 current
22 June 2023
- 12:1712:17, 22 June 2023 diff hist +4 XB-FEAT-992706 →nomenclature changes current
- 12:1612:16, 22 June 2023 diff hist +1,059 XB-FEAT-992706 →nomenclature changes
- 12:1012:10, 22 June 2023 diff hist +461 XB-FEAT-992706 →ca13
- 12:0212:02, 22 June 2023 diff hist +5 XB-FEAT-992706 →ca13
21 June 2023
- 12:1012:10, 21 June 2023 diff hist +182 XB-FEAT-981838 →exog current
- 11:2711:27, 21 June 2023 diff hist +5 XB-FEAT-5846793 →znf33b current
- 11:2011:20, 21 June 2023 diff hist +676 XB-FEAT-29087790 →RefSeq protein accession current
- 11:1011:10, 21 June 2023 diff hist +589 N XB-FEAT-29087790 Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH..."
- 11:0811:08, 21 June 2023 diff hist +849 XB-FEAT-29077586 →refSeq protein accession current
- 11:0011:00, 21 June 2023 diff hist +747 N XB-FEAT-29077586 Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF..."
- 10:5510:55, 21 June 2023 diff hist −1 XB-FEAT-29097482 →nomenclature changes current
- 10:5510:55, 21 June 2023 diff hist +687 N XB-FEAT-29097482 Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc..."
- 10:3810:38, 21 June 2023 diff hist +588 N XB-FEAT-29099066 Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase...." current
- 10:2710:27, 21 June 2023 diff hist +15 XB-FEAT-29091390 →nomenclature changes current
- 10:2610:26, 21 June 2023 diff hist +439 N XB-FEAT-29091390 Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''..."
- 07:4007:40, 21 June 2023 diff hist +153 XB-FEAT-6046830 →padi4 current
- 07:3107:31, 21 June 2023 diff hist +155 XB-FEAT-996813 →padi2 current
20 June 2023
- 12:2112:21, 20 June 2023 diff hist +4 XB-FEAT-5789487 →ptgr1 current
- 12:2112:21, 20 June 2023 diff hist +10 XB-FEAT-5789487 →nomenclature updates
- 12:2012:20, 20 June 2023 diff hist −2 XB-FEAT-5789487 →ptgr1.1
17 June 2023
- 19:1319:13, 17 June 2023 diff hist +400 XB-FEAT-482447 →tdgf1
- 19:0919:09, 17 June 2023 diff hist +307 XB-FEAT-5995511 →nomenclature changes current
- 19:0419:04, 17 June 2023 diff hist +151 XB-FEAT-1217654 →bnc1 current
- 19:0119:01, 17 June 2023 diff hist +145 XB-FEAT-953156 →bnc2 current
- 18:5918:59, 17 June 2023 diff hist +135 XB-FEAT-920751 →shox current
- 18:5718:57, 17 June 2023 diff hist +138 XB-FEAT-480992 →shox2 current
16 June 2023
- 16:4416:44, 16 June 2023 diff hist +15 XB-FEAT-22063241 →nomenclature changes current
- 16:4416:44, 16 June 2023 diff hist +440 N XB-FEAT-22063241 Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte..."
- 10:3310:33, 16 June 2023 diff hist +4 XB-FEAT-491910 →il17bl current
- 10:3310:33, 16 June 2023 diff hist +137 XB-FEAT-491910 →il17bl
- 08:1108:11, 16 June 2023 diff hist +1 XB-FEAT-29093310 →nomenclature changes current
- 08:1108:11, 16 June 2023 diff hist +385 N XB-FEAT-29093310 Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher..."
15 June 2023
- 11:3911:39, 15 June 2023 diff hist +11 XB-FEAT-950176 →gene annotation corrections current
- 11:3511:35, 15 June 2023 diff hist +10 XB-FEAT-960657 →gene annotation corrections current
- 11:1611:16, 15 June 2023 diff hist +25 XB-FEAT-29077890 →cupin1.2 current
- 11:1411:14, 15 June 2023 diff hist +1,432 N XB-FEAT-29077890 Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro..."