All public logs
Jump to navigation
Jump to search
Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20181008 Angerilli et al - figure.jpg
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20181008 Angerilli et al - figure.jpg
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20181008 Angerilli et al - fig 3.png
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20181008 Angerilli et al - fig 3.png
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20181008 Angerilli et al - fig 2.png
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20181008 Angerilli et al - fig 2.png
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20181008 Angerilli et al - fig 1.png
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20181008 Angerilli et al - fig 1.png
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20180613 Szenker-Ravi et al - fig s7.jpg
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20180613 Szenker-Ravi et al - fig s7.jpg
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20180613 Szenker-Ravi et al - fig 4.jpg
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20180613 Szenker-Ravi et al - fig 4.jpg
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20180613 Szenker-Ravi et al - fig 1.jpg
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20180613 Szenker-Ravi et al - fig 1.jpg
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20180508 Briggs et al - fig 7.jpg
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20180508 Briggs et al - fig 7.jpg
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20180508 Briggs et al - fig 4.jpg
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20180508 Briggs et al - fig 4.jpg
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20180508 Briggs et al - fig 1.jpg
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20180508 Briggs et al - fig 1.jpg
- 11:08, 23 February 2024 BArsh talk contribs created page File:MM 20180315 Scerbo et al - fig 2.png
- 11:08, 23 February 2024 BArsh talk contribs uploaded File:MM 20180315 Scerbo et al - fig 2.png
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20180315 Scerbo et al - fig 1.png
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20180315 Scerbo et al - fig 1.png
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20180306 Barriga et al - news.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20180306 Barriga et al - news.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20180306 Barriga et al - fig 4.png
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20180306 Barriga et al - fig 4.png
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20180306 Barriga et al - fig 2.png
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20180306 Barriga et al - fig 2.png
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20180306 Barriga et al - fig 1.png
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20180306 Barriga et al - fig 1.png
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171227 Xenbase v4.7 summary.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171227 Xenbase v4.7 summary.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171227 Xenbase v4.7 coregulation.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171227 Xenbase v4.7 coregulation.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171212 Peuchen et al - graphical abstract.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171212 Peuchen et al - graphical abstract.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171129 Presler et al - teaser figure.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171129 Presler et al - teaser figure.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171109 Xenbase v4.6 - fig 4.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171109 Xenbase v4.6 - fig 4.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171109 Xenbase v4.6 - fig 3.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171109 Xenbase v4.6 - fig 3.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171109 Xenbase v4.6 - fig 2.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171109 Xenbase v4.6 - fig 2.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20171109 Xenbase v4.6 - fig 1.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20171109 Xenbase v4.6 - fig 1.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20170814 Canty et al - figure 3.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20170814 Canty et al - figure 3.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20170814 Canty et al - figure 2.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20170814 Canty et al - figure 2.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20170814 Canty et al - figure 1.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20170814 Canty et al - figure 1.jpg
- 11:07, 23 February 2024 BArsh talk contribs created page File:MM 20170720 Shintomi chromosome figure.jpg
- 11:07, 23 February 2024 BArsh talk contribs uploaded File:MM 20170720 Shintomi chromosome figure.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170705 Onjiko et al - figure 4.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170705 Onjiko et al - figure 4.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170705 Onjiko et al - figure 2.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170705 Onjiko et al - figure 2.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170705 Onjiko et al - figure 1.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170705 Onjiko et al - figure 1.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170705 Onjiko et al - abstract.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170705 Onjiko et al - abstract.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170630 Philippe Soriano.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170630 Philippe Soriano.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170630 Maria Barna.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170630 Maria Barna.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170628 Drew et al - graphical abstract.gif
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170628 Drew et al - graphical abstract.gif
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170628 Drew et al - figure 7.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170628 Drew et al - figure 7.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170628 Drew et al - figure 5.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170628 Drew et al - figure 5.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170628 Drew et al - figure 1.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170628 Drew et al - figure 1.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170627 xenbase v4.4 screenshot 6.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170627 xenbase v4.4 screenshot 6.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170627 xenbase v4.4 screenshot 5.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170627 xenbase v4.4 screenshot 5.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170627 xenbase v4.4 screenshot 4.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170627 xenbase v4.4 screenshot 4.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170627 xenbase v4.4 screenshot 3.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170627 xenbase v4.4 screenshot 3.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170627 xenbase v4.4 screenshot 2.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170627 xenbase v4.4 screenshot 2.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170627 xenbase v4.4 screenshot 1.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170627 xenbase v4.4 screenshot 1.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170216 GO on xenbase 2.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170216 GO on xenbase 2.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 20170208 genesis special issue-1.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 20170208 genesis special issue-1.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 2016 NAS USA members.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 2016 NAS USA members.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 2016 NAS foreign associates.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 2016 NAS foreign associates.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 2015 GRC DB.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 2015 GRC DB.jpg
- 11:06, 23 February 2024 BArsh talk contribs created page File:MM 16th IXC banner.jpg
- 11:06, 23 February 2024 BArsh talk contribs uploaded File:MM 16th IXC banner.jpg
- 10:57, 23 February 2024 BArsh talk contribs created page File:MM 15thIXC.jpg
- 10:57, 23 February 2024 BArsh talk contribs uploaded File:MM 15thIXC.jpg
- 11:43, 14 February 2024 VG talk contribs created page File:Xenbase1920x1080.mp4
- 11:43, 14 February 2024 VG talk contribs uploaded File:Xenbase1920x1080.mp4
- 11:42, 14 February 2024 VG talk contribs created page File:Xenbase-single cleaving embryo1920x1080.mp4
- 11:42, 14 February 2024 VG talk contribs uploaded File:Xenbase-single cleaving embryo1920x1080.mp4
- 11:41, 14 February 2024 VG talk contribs created page File:When it all goes wrong.mp4
- 11:41, 14 February 2024 VG talk contribs uploaded File:When it all goes wrong.mp4
- 11:41, 14 February 2024 VG talk contribs created page File:Single embryo to late blastula.mp4
- 11:41, 14 February 2024 VG talk contribs uploaded File:Single embryo to late blastula.mp4
- 11:40, 14 February 2024 VG talk contribs created page File:Single embryo sequence.mp4
- 11:40, 14 February 2024 VG talk contribs uploaded File:Single embryo sequence.mp4
- 11:40, 14 February 2024 VG talk contribs created page File:Short feeding clip 3.mp4
- 11:40, 14 February 2024 VG talk contribs uploaded File:Short feeding clip 3.mp4
- 11:39, 14 February 2024 VG talk contribs created page File:Gastrulation viewed fron anim pole.mp4
- 11:39, 14 February 2024 VG talk contribs uploaded File:Gastrulation viewed fron anim pole.mp4
- 11:38, 14 February 2024 VG talk contribs created page File:Blastopore closure.mp4
- 11:38, 14 February 2024 VG talk contribs uploaded File:Blastopore closure.mp4
- 11:37, 14 February 2024 VG talk contribs created page File:Blastopore closure-neural plate formation.mp4
- 11:37, 14 February 2024 VG talk contribs uploaded File:Blastopore closure-neural plate formation.mp4
- 12:33, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - slider.png
- 12:33, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - slider.png
- 12:33, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - Figure 5.jpeg
- 12:33, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - Figure 5.jpeg
- 12:33, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - Figure 3.jpeg
- 12:33, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - Figure 3.jpeg
- 12:32, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - Figure 2.jpeg
- 12:32, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - Figure 2.jpeg
- 12:32, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - graphical abstract.jpeg
- 12:32, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - graphical abstract.jpeg
- 11:51, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - Figure 7.jpeg
- 11:51, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - Figure 7.jpeg
- 11:51, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - Figure 3.jpeg
- 11:51, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - Figure 3.jpeg
- 11:50, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - Figure 1.jpeg
- 11:50, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - Figure 1.jpeg
- 11:50, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - slider.png
- 11:50, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - slider.png
- 11:13, 13 February 2024 VG talk contribs created page File:20240213 xenbase valentines day - slider.png
- 11:13, 13 February 2024 VG talk contribs uploaded File:20240213 xenbase valentines day - slider.png
- 11:11, 13 February 2024 VG talk contribs deleted page File:20240213 xenbase valentines day - slider.png
- 11:09, 13 February 2024 VG talk contribs created page File:20240213 xenbase valentines day - slider.png
- 11:09, 13 February 2024 VG talk contribs uploaded File:20240213 xenbase valentines day - slider.png
- 11:08, 13 February 2024 VG talk contribs created page File:20240213 xenopus two frogs.jpg
- 11:08, 13 February 2024 VG talk contribs uploaded File:20240213 xenopus two frogs.jpg
- 09:13, 7 February 2024 Xenbase talk contribs created page XB-FEAT-29209259 (Created page with "=gfod3= There was an assigned model for an ''X. laevis'' ''gfod3.S'' gene but this clashed both in model ID and NCBi gene ID with the ''tp73.S'' gene. Subsequent investigation faored the ''tp73.S'' gene assignment so the model and NCBI gene associateion were removed from ''gfod3.S''. (2/7/2024)")
- 15:32, 5 February 2024 Xenbase talk contribs created page XB-FEAT-29079722 (Created page with "=''gucy2dl''= This is the Xenbase wiki page for the ''Xenopus gucy2dl'' gene(s). Please feel free to record here any relevant information that is not captured elsewhere on Xenbase. =nomenclature changes= 05FEB2024 ''Xenopus'' gene symbol change from LOC100489435 to ''gucy2dl''. Note that true ''gucy2d'', the ortholog of the human GUCY2D gene, is on chromosome 3 in ''X. tropicalis'', and this ''like'' gene is on Chr2.")
- 13:28, 31 January 2024 Xenbase talk contribs created page File:Screenshot 2024-01-31 at 9.06.08 AM.png
- 13:28, 31 January 2024 Xenbase talk contribs uploaded File:Screenshot 2024-01-31 at 9.06.08 AM.png
- 11:32, 31 January 2024 VG talk contribs created page File:20240131 from stem cells to human development - slider.png
- 11:32, 31 January 2024 VG talk contribs uploaded File:20240131 from stem cells to human development - slider.png
- 10:30, 29 January 2024 VG talk contribs created page File:20240129 sdb website image collection - slider.png
- 10:30, 29 January 2024 VG talk contribs uploaded File:20240129 sdb website image collection - slider.png
- 12:41, 24 January 2024 ABell talk contribs created page XB-FEAT-29099062 (Created page with "=''naip.3''= This is the community wiki page for the gene ''naip.3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 24JAN2024 The following synteny was used to determine new gene names for the ''naip'' genes in ''Xenopus tropicalis'' and ''Xenopus laevis''. There are only L subgenome orthologs of the ''naip'' genes in ''X. laevis''. '''''X. tropicalis''''' - ''olcn''> ''gtf2h2...")
- 12:39, 24 January 2024 ABell talk contribs created page XB-FEAT-29091370 (Created page with "=''naip''= This is the community wiki page for the gene ''naip'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 24JAN2024 The following synteny was used to determine new gene names for the ''naip'' genes in ''Xenopus tropicalis'' and ''Xenopus laevis''. There are only L subgenome orthologs of the ''naip'' genes in ''X. laevis''. '''''X. tropicalis''''' - ''olcn''> ''gtf2h2''> '...")
- 12:52, 23 January 2024 ABell talk contribs created page XB-FEAT-29085226 (Created page with "=nlrp3l= This is the community wiki page for the gene ''nlrp3l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 23JAN2024 Gene symbol changed from ''LOC101731251'' to ''nlrp3l'' to reflect that it is like the NLRP3 genes in humans, while we work out the specific family and member number of this particular gene in an ongoing review of NLR type genes. Also the ''X. laevis'' L subgen...")
- 16:16, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 4.jpeg
- 16:16, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 4.jpeg
- 16:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 3.jpeg
- 16:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 3.jpeg
- 16:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 1.jpeg
- 16:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 1.jpeg
- 16:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - graphical abstract.jpeg
- 16:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - graphical abstract.jpeg
- 16:14, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - slider.png
- 16:14, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - slider.png
- 14:36, 9 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
- 14:36, 9 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
- 14:36, 9 January 2024 VG talk contribs deleted page File:20240108 83rd SDB meeting - slider.png
- 14:35, 9 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
- 14:35, 9 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
- 14:34, 9 January 2024 VG talk contribs deleted page File:20240108 83rd SDB meeting - slider.png (replace with new version)
- 12:09, 8 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
- 12:09, 8 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
- 07:03, 8 January 2024 Xenbase talk contribs created page XB-FEAT-22041699 (Created page with "=fim-a.1=")
- 12:24, 4 January 2024 Xenbase talk contribs changed group membership for Christina from (none) to administrator and bureaucrat
- 12:24, 4 January 2024 Xenbase talk contribs changed group membership for Kkarimi from (none) to administrator, interface administrator, bureaucrat and suppressor
- 15:44, 3 January 2024 Xenbase talk contribs created page File:Figure 003.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 003.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs created page File:Figure 002.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 002.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs created page File:Figure 001.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs uploaded File:Figure 001.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs created page File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs uploaded File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
- 11:52, 3 January 2024 VG talk contribs created page File:20240103 xenbase wiki image test.png
- 11:52, 3 January 2024 VG talk contribs uploaded File:20240103 xenbase wiki image test.png
- 08:30, 3 January 2024 Xenbase talk contribs created page XB-FEAT-29209255 (Created page with "=nfil3l.2= This is the Xenbase wiki page for the ''Xenopus nfil3l.2'' genes. Please feel free to record here any information about these genes that is not captured elsewhere on Xenbase. =nomenclature changes= 01JAN2024 The ''Xenopus laevis nfil3l.2.L'', nuclear factor interleukin 3 regulated like gene 2 [NCBI GeneID: 447503] is on Chr4L, [v10 gene model: XBXL10_1g19722] and has been placed here on its own gene page. We can not find any paralogous ''nfil3l.2'' gene...")
- 20:23, 15 December 2023 Christina talk contribs created page XB-FEAT-29099462 (Created page with "=smim38= This is the community wiki page for the gene ''smim38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 15DEC2023 The ''X. laevis'' L gene previously annotated as ''LOC121402925.L'' (Xenbase v10 gene model XBXL10_1g17811) is determined to be the L homeolog of the ''smim38'' gene, due to synteny and sequence similarity with ''X. tropicalis'' ''smim38''.")
- 13:57, 14 December 2023 Xenbase talk contribs created page XB-FEAT-22164454 (Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it.")
- 10:21, 11 December 2023 Xenbase talk contribs created page XB-FEAT-29084766 (Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS...")
- 10:34, 5 December 2023 Xenbase talk contribs created page XB-FEAT-22169226 (Created page with "=''chst9l.2''=")
- 13:46, 4 December 2023 Xenbase talk contribs created page XB-FEAT-29078026 (Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH...")
- 07:46, 30 November 2023 Xenbase talk contribs created page File:Six6 synteny.png
- 07:46, 30 November 2023 Xenbase talk contribs uploaded File:Six6 synteny.png
- 14:12, 18 October 2023 Xenbase talk contribs created page File:Screenshot 2023-10-18 at 4.10.09 PM.png
- 14:12, 18 October 2023 Xenbase talk contribs uploaded File:Screenshot 2023-10-18 at 4.10.09 PM.png
- 13:38, 18 October 2023 Xenbase talk contribs created page XB-FEAT-18034121 (Created page with "=''rho.2''= This is the community wiki page for the ''Xenopus rho.2'' genes. Please add here any relevant information pertaining to these genes, if it is not represented elsewhere on Xenbase. =annotation and synteny= Note that this gene is a duplicate of the adjacent ''rho'' gene, on Chromosome 4, but is only seen in ''X. laeivs'' L subgenome. In v10 assemblies: ''Xtr.chr4: mbd4< ift122> rho> h1-8> plxnd1<'' ''Xla.4L:mbd4.L< ift122.L> rho.L> '''rho.2.L>''' h1-8.L>...")
- 12:00, 18 October 2023 Xenbase talk contribs created page XB-FEAT-22065720 (Created page with "=opn7a= =summary from NCBI= Predicted to enable G protein-coupled receptor activity and photoreceptor activity. Acts upstream of or within phototransduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in several structures, including brain; digestive system; eye; heart; and testis. [provided by Alliance of Genome Resources, Apr 2022]")
- 13:01, 17 October 2023 Xenbase talk contribs created page XB-FEAT-29083966 (Created page with "= opn6bl= This is the Xenbase wiki page for the Xenopus genes 'opn6bl''. Fee; free to record anything here about these genes a=thata are not recorded elsewhere on Xenbase. =nomenclature changes= 18OCT2023 The gene symbol and names for the opsin gens where updated, provisionally, replacing the ''LOC 100497987, visual pigment-like receptor peropsin'' with ''opn6bl, visual pigment-like receptor peropsin 6b like'', which combines the X.tropicalis gene /protein name with th...")
- 08:03, 10 October 2023 Xenbase talk contribs created page XB-FEAT-22063928 (Created page with "=''notch4''= This is the community wiki page for the gene ''notch4'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =gene nomenclature and annotation notes= In ''X. laevis'', on chromosome 8L, LOC121397048 is the gene next to ''tap2.L'' and we propose that represents a non-coding fragment of ''notch4''. This annotation was based on BLAST of notch4.S XM_041575228.1, which identified the loci n...")
- 14:49, 9 October 2023 Xenbase talk contribs created page File:Undefined-4.pdf
- 14:49, 9 October 2023 Xenbase talk contribs uploaded File:Undefined-4.pdf
- 14:48, 9 October 2023 Xenbase talk contribs created page File:Undefined-3.pdf
- 14:48, 9 October 2023 Xenbase talk contribs uploaded File:Undefined-3.pdf
- 13:02, 9 October 2023 Xenbase talk contribs created page XB-FEAT-22062677 (Created page with "=''cx38''= This is the community wiki page for the gene ''cx38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature= 09 OCTOBER 2023 Note: no other vertebrate genes are called ''cx38'', just ''X. trop'' GeneID:100170463, and ''X. laevis'' GeneID:397866. The Synonym given is ''gja2'', which in NCBI is currently only assigned to genes in a large number of fish species, but no other vert...")
- 15:14, 5 October 2023 Xenbase talk contribs created page File:Stage44ventral.jpg
- 15:14, 5 October 2023 Xenbase talk contribs uploaded File:Stage44ventral.jpg
- 13:22, 5 October 2023 Xenbase talk contribs uploaded File:Herbimycin.png
- 10:51, 5 October 2023 Xenbase talk contribs uploaded File:Krylov FISH-TSA protocol.pdf
- 10:50, 5 October 2023 Xenbase talk contribs uploaded File:Slc45a2 - Start Codon - Consensus.pdf
- 10:50, 5 October 2023 Xenbase talk contribs uploaded File:Slc45a2 - tBLASTn.pdf
- 10:49, 5 October 2023 Xenbase talk contribs uploaded File:Slc45a2 - Multi-sequence alignment.pdf
- 07:45, 2 October 2023 Xenbase talk contribs created page XB-FEAT-29093450 (Created page with "=''cyp27a1.2''= his is the community wiki page for the gene ''cyp27a1.2'' please feel free to add any information that is relevant to this gene that is not already captured el...")
- 12:39, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072323 (Created page with "=''b3galt2l.9''= This is the community wiki page for the gene ''b3galt2l.9'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:38, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072343 (Created page with "=''b3galt2l.8''= This is the community wiki page for the gene ''b3galt2l.8'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:37, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072311 (Created page with "=''b3galt2l.7''= This is the community wiki page for the gene ''b3galt2l.7'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:35, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072339 (Created page with "=''b3galt2l.6''= This is the community wiki page for the gene ''b3galt2l.6'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:33, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072396 (Created page with "=''b3galt2l.5''= This is the community wiki page for the gene ''b3galt2l.5'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:32, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072315 (Created page with "=''b3galt2l.4''= This is the community wiki page for the gene ''b3galt2l.4'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:31, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072356 (Created page with "=''b3galt2l.3''= This is the community wiki page for the gene ''b3galt2l.3'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:31, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072368 (Created page with "=''b3galt2l.2''= This is the community wiki page for the gene ''b3galt2l.2'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:30, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072327 (Created page with "=''b3galt2l.12''= This is the community wiki page for the gene ''b3galt2l.12'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 12:30, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072331 (Created page with "=''b3galt2l.11''= This is the community wiki page for the gene ''b3galt2l.11'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 12:29, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072376 (Created page with "=''b3galt2l.10''= This is the community wiki page for the gene ''b3galt2l.10'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 12:06, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072384 (Created page with "=''b3galt2l.13''= This is the community wiki page for the gene ''b3galt2l.13'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 11:49, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072360 (Created page with "=b3galt2l.1= This is the community wiki page for the gene ''b3galt2l.1'' please feel free to add any information that is relevant to this gene that is not already captured els...")
- 07:50, 20 September 2023 Xenbase talk contribs created page XB-FEAT-6469275 (Created page with " = ''nhsl3''= This is the community wiki page for the gene ''nhsl3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:45, 19 September 2023 Xenbase talk contribs created page File:Mhc2.daa2 msa.png
- 11:45, 19 September 2023 Xenbase talk contribs uploaded File:Mhc2.daa2 msa.png
- 07:54, 19 September 2023 Xenbase talk contribs created page XB-FEAT-29081898 (Created page with "=''ces2.7''= This is the community wiki page for the gene ''ces2.7'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 16:07, 18 September 2023 Xenbase talk contribs created page XB-FEAT-29096122 (Created page with "=''ces2.5''= This is the community wiki page for the gene ''ces2.5'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 15:35, 18 September 2023 Xenbase talk contribs created page XB-FEAT-29081994 (Created page with "=''ces2.2''= This is the community wiki page for the gene ''ces2.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 15:00, 18 September 2023 Xenbase talk contribs created page File:Screenshot 2023-09-18 at 3.06.15 PM.png
- 15:00, 18 September 2023 Xenbase talk contribs uploaded File:Screenshot 2023-09-18 at 3.06.15 PM.png
- 08:35, 14 September 2023 Xenbase talk contribs created page XB-FEAT-29085838 (Created page with "=''adam33''= This is the community wiki page for the gene ''adam33'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 12:39, 12 September 2023 Christina talk contribs created page XB-FEAT-23659672 (Created page with "=''cxcl8b''=")
- 12:18, 12 September 2023 Christina talk contribs created page XB-FEAT-29208828 (Created page with "=''il18.2''= This is the community wiki page for the gene ''il18.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:34, 12 September 2023 Christina talk contribs created page XB-FEAT-6460977 (Created page with "=''il22ra1''= This is the community wiki page for the gene ''il22ra1'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 10:06, 11 September 2023 Christina talk contribs created page XB-FEAT-22201451 (Created page with "= flt3lg = This is the community wiki page for the gene ''flt3lg'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 11:05, 17 August 2023 VG talk contribs created page File:Embryo microinjection.mp4
- 11:05, 17 August 2023 VG talk contribs uploaded File:Embryo microinjection.mp4
- 11:03, 17 August 2023 VG talk contribs created page File:Embryo microinjection.png
- 11:03, 17 August 2023 VG talk contribs uploaded File:Embryo microinjection.png
- 11:01, 17 August 2023 VG talk contribs deleted page File:Embryo microinjection.png
- 11:01, 17 August 2023 VG talk contribs created page File:Embryo microinjection.png
- 11:01, 17 August 2023 VG talk contribs uploaded File:Embryo microinjection.png
- 08:29, 17 August 2023 Christina talk contribs created page XB-FEAT-22068404 (Created page with "=''''= This is the community wiki page for the gene ''vcf1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X...")
- 14:13, 16 August 2023 VG talk contribs created page File:Adult xenopus tropicalis 03 albino.mp4
- 14:13, 16 August 2023 VG talk contribs uploaded File:Adult xenopus tropicalis 03 albino.mp4