XB-FEAT-17329844: Difference between revisions
Jump to navigation
Jump to search
(Created page with "=''symbol''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...") |
|||
Line 6: | Line 6: | ||
26APRIL2023 | 26APRIL2023 | ||
gene symbol and name changed from XB17329844 [provisional] to ''prss57, serine protease 57'' | |||
=protein for GeneID:100497492= | =protein for GeneID:100497492= |
Revision as of 10:57, 26 April 2023
symbol
This is the community wiki page for the gene symbol please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
26APRIL2023
gene symbol and name changed from XB17329844 [provisional] to prss57, serine protease 57
protein for GeneID:100497492
>XP_002937430.1 serine protease 57 [Xenopus tropicalis]
MMMHLVLLTAALFSLPSSETYRIVGGHEAKPHSRPYMVSLQRQDKSHFCGGTLIHPKWVLTAAHCQEGWS MDLTRVVLGAHWLYWSDRPVQVFRTLKFVQHPQFNPQTFQSDLLLLKLNDSVHFSPAVRTIPLPAPNTDV IPGTACSVAGWGLTSDSGTRPFALMEADVDVISRMSCNKTWLGGIDESMLCTATPGAPFKGFCDGDSGGP LVCGDRVEGVVSFSGSYCGDPHTPDVYTRVTSFLDWIQETISEF