XB-FEAT-22167168: Difference between revisions
(Created page with "=rchy1.2= This is the community wiki page for the ''Xenopus'' gene ''rchy1.2''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase....") |
|||
| Line 1: | Line 1: | ||
=rchy1.2= | =''rchy1.2''= | ||
This is the community wiki page for the ''Xenopus'' gene ''rchy1.2''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase. | This is the community wiki page for the ''Xenopus'' gene ''rchy1.2''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase. | ||
Revision as of 12:27, 25 April 2023
rchy1.2
This is the community wiki page for the Xenopus gene rchy1.2. Feel free to note here anything about rchy1.2 that is not recorded elsewhere on Xenbase.
nomenclature changes
04JAN2023
gene name was changed from XB22167168 to ring finger and CHY zinc finger domain containing 1 gene 2
gene synbol was changed from uncharacterized XB22167168 to rchy1.2
Using the DIOPT Eggnog tool the protein from this gene found on Xenopus Chr3/3L (v10 genome assemblies) matches Rchy1 ring finger and CHY zinc finger domain containing 1 in 447 species with high confidence. True RCHY1 orthologs are however the genes on Chr1/1L. This gene will therefore be provisionally named rchy1.2
=protein sequence for X. tropicalis rchy1.2 used in orthology group analysis
MAEGQVQSVKVPPVNEDGVTCSQEKFHRQQPQHLCKFFSQGRYCRFGNRCRFLHQLAECQNSEKNRKQNVSCKLTEKSNATAISCSPNNS FSDPVKKGLGSHQRKYQPRKLCRYFASGFCAMENHCKFWHPDNHPPINDGHPQDKKAAATSTVVRMPVERPQALPESLRFGDVTLDMAKK LRETEISQLLKRFPKDKVIVQEREDGEVTYYRVTVEPTDPDWPFDLKEMEIMLEFPDDYPLKVFTVQIPEDQDLPPVMCRHVREASLTWL EAKHATNQLIGKVELLFRPYLHWLDRNMERLFTEGARLLKRDVDAEKAGIEFVPYQQLQALVIESSCDKSARETVTQNNPEDPPDESLEE DSDDWTSCDDDDDDDELEPGPDDRMKSIEGGGTEAPKKGTEIRFLGLKLGEDVGTLMAHCISVSLQCNRCQTIADLSVSGRQPCTAQCDR CNSRISGAFHPRVIHQFSAVLGYVDIQGASPKDLILQDCDFIFSCLSCSQEGQVQSLSYGIPKDLNCLHCHCKLSISVEATKFQKVERCP AKIIGSKGLLNQGRKRAVKDPSIQPGKPLPDHGTCRHYRKSCRWLRFPCCGKAYPCDVCHDDAEDHEMELASRMICGYCAKEQAYTNGKP CTSCGNMMSKGLHSGHWEGGRGCRNKVKMSRKDKQKYANSSKTVSRRSVSKF