XB-FEAT-5822256: Difference between revisions
imported>Xenbase (→loc100124990: Updated nomenclature, replaced: unnamed → loc100124990 (2)) |
|||
(2 intermediate revisions by the same user not shown) | |||
Line 1: | Line 1: | ||
=loc100124990= | =loc100124990= | ||
This is the community wiki page for the gene ''loc100124990'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | This is the community wiki page for the gene ''loc100124990'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=nomenclature changes= | |||
16MAY2023 | |||
''Xenopus'' gene symbol changed from ''XB5822256 [provisional:cdc42ep2]'' to ''cdc42ep2l'' | |||
''Xenopus'' gene name changed from ''provisonal orthology of CDC42 effector protein 2'' to ''CDC42 effector protein 2 like'' | |||
=synteny and orthology= | |||
Synteny is broken, thus it does not confirm this gene as the ortholog of CDC42EP2 | |||
However DIOPT/EggNog analysis of LOC100124990 protein [Xenopus tropicalis] matches 22 proteins in 22 species as cdc42 effector, and 81 proteins in 81 species as cdc42ep2, including ''Xenopus (Silurana) ENSXETP00000050314 cdc42ep2'' | |||
=protein sequence used in DIOPT anlaysis= | |||
>AAI35992.1 LOC100124990 protein [Xenopus tropicalis] | |||
MPAKTPIYLKTSTPKRGKKPKLRDVLSSEMISPPLGDFRHSAHIGLDGEGDMFGELSFLQGKYDLLPSMG | |||
RKFTIHSTDTSLDEEYHSDAGHASYRPYLKNAVSLPAFSAPHSKERAPPKPPRLHLEETPSQRSMSISYG | |||
ERCFSRDENVSFASIPLDQESSNLEVYDSSSEGSINEDGAQSLGSTSDPMQKKQRQPNHPGTRHSKIRVPLWA | |||
Based on the DIOPT analysis, this gene can be provisionally called ''cdc42ep2l'' with a degree of confidence. |
Latest revision as of 12:31, 16 May 2023
loc100124990
This is the community wiki page for the gene loc100124990 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
16MAY2023
Xenopus gene symbol changed from XB5822256 [provisional:cdc42ep2] to cdc42ep2l
Xenopus gene name changed from provisonal orthology of CDC42 effector protein 2 to CDC42 effector protein 2 like
synteny and orthology
Synteny is broken, thus it does not confirm this gene as the ortholog of CDC42EP2
However DIOPT/EggNog analysis of LOC100124990 protein [Xenopus tropicalis] matches 22 proteins in 22 species as cdc42 effector, and 81 proteins in 81 species as cdc42ep2, including Xenopus (Silurana) ENSXETP00000050314 cdc42ep2
protein sequence used in DIOPT anlaysis
>AAI35992.1 LOC100124990 protein [Xenopus tropicalis]
MPAKTPIYLKTSTPKRGKKPKLRDVLSSEMISPPLGDFRHSAHIGLDGEGDMFGELSFLQGKYDLLPSMG RKFTIHSTDTSLDEEYHSDAGHASYRPYLKNAVSLPAFSAPHSKERAPPKPPRLHLEETPSQRSMSISYG ERCFSRDENVSFASIPLDQESSNLEVYDSSSEGSINEDGAQSLGSTSDPMQKKQRQPNHPGTRHSKIRVPLWA
Based on the DIOPT analysis, this gene can be provisionally called cdc42ep2l with a degree of confidence.