XB-FEAT-6538722: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 7: Line 7:
The orthology of these ''Xenopus'' ''esr-5'' genes is unassigned as of  4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species).
The orthology of these ''Xenopus'' ''esr-5'' genes is unassigned as of  4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species).


protein domains therefore  
protein domains
 
=protein sequnces=
 
>uncharacterized protein LOC100135364 [Xenopus tropicalis]
mpdmeysdtfpsrkilkpvvekqrrdrinrsleemrvlllkltgnqklqnpkmekaeilelaviyirnvthmkthdasqwvspaeklylsgfrecldrtedfiseispkaravfldnlqthlqqrlhfptqvglggpgrdheedlmssgnglspimdysisrddlslctppsslssesgspqqwlpasppnqheqapfyiwrpwp
 
 
 
 
therefore  
hairy and enhancer of split 2/6/7,hairy and enhancer of split related with YRPW motif,hairy and enhancer of split 5
hairy and enhancer of split 2/6/7,hairy and enhancer of split related with YRPW motif,hairy and enhancer of split 5

Revision as of 08:51, 4 April 2024

esr-5

This is the community wiki page for the gene esr-5 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

annotation notes

04.04.2024

The orthology of these Xenopus esr-5 genes is unassigned as of 4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species).

protein domains

protein sequnces

>uncharacterized protein LOC100135364 [Xenopus tropicalis] mpdmeysdtfpsrkilkpvvekqrrdrinrsleemrvlllkltgnqklqnpkmekaeilelaviyirnvthmkthdasqwvspaeklylsgfrecldrtedfiseispkaravfldnlqthlqqrlhfptqvglggpgrdheedlmssgnglspimdysisrddlslctppsslssesgspqqwlpasppnqheqapfyiwrpwp



therefore 

hairy and enhancer of split 2/6/7,hairy and enhancer of split related with YRPW motif,hairy and enhancer of split 5