<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
	<id>https://wiki.xenbase.org/xenwiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xenbase</id>
	<title>XenWiki - User contributions [en]</title>
	<link rel="self" type="application/atom+xml" href="https://wiki.xenbase.org/xenwiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xenbase"/>
	<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php/Special:Contributions/Xenbase"/>
	<updated>2026-06-24T07:52:35Z</updated>
	<subtitle>User contributions</subtitle>
	<generator>MediaWiki 1.44.2</generator>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-495302&amp;diff=55626</id>
		<title>XB-FEAT-495302</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-495302&amp;diff=55626"/>
		<updated>2026-06-18T15:21:05Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* hsp90aa1.1 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;hsp90aa1&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;hsp90aa1.1&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature changes=&lt;br /&gt;
01/12/2016&lt;br /&gt;
Human name has changed for Entrez Gene: 3320. From heat shock protein 90kDa alpha (cytosolic), class A member 1 to heat shock protein 90kDa alpha family class A member 1&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-484087&amp;diff=55625</id>
		<title>XB-FEAT-484087</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-484087&amp;diff=55625"/>
		<updated>2026-06-15T20:56:38Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* pax6 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;pax6&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus pax6&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature changes=&lt;br /&gt;
&lt;br /&gt;
HGNC records previous name as: AN2, &amp;quot;paired box gene 6 (aniridia, keratitis)&amp;quot; .&lt;br /&gt;
&lt;br /&gt;
HGNC records Synonyms as:   AN, &amp;quot;aniridia, keratitis&amp;quot;, D11S812E, WAGR&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087646&amp;diff=55624</id>
		<title>XB-FEAT-29087646</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087646&amp;diff=55624"/>
		<updated>2026-06-15T20:40:22Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* prr33 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;prr33&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus prr33&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=annotation notes=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&lt;br /&gt;
The  &#039;&#039;X.laevis. prr33.L&#039;&#039; gene&#039;s encoded  protein has a very different name, however, the protein sequence matches the PRR33 orthology proup in EggNog5.0, and is supported by synteny.&lt;br /&gt;
So I have added it to this page!  NB:here is no &#039;&#039;prr33.S&#039;&#039; model in the v10 annotation that I can see in the immediate vicinity of expected  flanking genes cf &#039;&#039;X. trop&#039;&#039; and &#039;&#039;X.laevis.L&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087646&amp;diff=55623</id>
		<title>XB-FEAT-29087646</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087646&amp;diff=55623"/>
		<updated>2026-06-15T20:36:25Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=&amp;#039;&amp;#039;prr33&amp;#039;&amp;#039;= This is the community wiki page for the &amp;#039;&amp;#039;Xenopus prr33&amp;#039;&amp;#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;prr33&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus prr33&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29093478&amp;diff=55622</id>
		<title>XB-FEAT-29093478</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29093478&amp;diff=55622"/>
		<updated>2026-06-15T20:02:28Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=&amp;#039;&amp;#039;medico.2&amp;#039;&amp;#039;=  This is the community wiki page for the &amp;#039;&amp;#039;Xenopus medico.2&amp;#039;&amp;#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.  =nomenclature changes= 15JUN2026  &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039; gene name was updated, changing from &amp;#039;&amp;#039;LOC116407919, meiosis-specific coiled-coil domain-containing protein MEIOC-like&amp;#039;&amp;#039; to &amp;#039;&amp;#039;meioc.2, meiosis-specific coiled-coil domain-containing protein MEIOC gene 2&amp;#039;&amp;#039;.   Note this is a...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;medico.2&#039;&#039;=&lt;br /&gt;
&lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus medico.2&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature changes=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name was updated, changing from &#039;&#039;LOC116407919, meiosis-specific coiled-coil domain-containing protein MEIOC-like&#039;&#039; to &#039;&#039;meioc.2, meiosis-specific coiled-coil domain-containing protein MEIOC gene 2&#039;&#039;. &lt;br /&gt;
&lt;br /&gt;
Note this is a tandem duplicate of &#039;&#039;meioc&#039;&#039;, and is also considered an ortholog of human MEIOC.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-941063&amp;diff=55621</id>
		<title>XB-FEAT-941063</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-941063&amp;diff=55621"/>
		<updated>2026-06-15T19:42:55Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* nomenclature */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;lrrc19l&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;lrrc19l&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase&lt;br /&gt;
&lt;br /&gt;
=nomenclature=&lt;br /&gt;
06/27/2024&lt;br /&gt;
&lt;br /&gt;
The gene symbol for XB-GENEPAGE-941063 was changed from &#039;&#039;lrrc19&#039;&#039; to &#039;&#039;lrrc19l&#039;&#039;, given shared synteny with human &#039;&#039;LRRC19&#039;&#039;. &lt;br /&gt;
&lt;br /&gt;
The true &#039;&#039;LRRC19&#039;&#039; gene sequence in human is located in the intronic region of the &#039;&#039;IFT74&#039;&#039; gene, which is flanked by &#039;&#039;TEK&#039;&#039; and &#039;&#039;CAAP1&#039;&#039; genes. &lt;br /&gt;
&lt;br /&gt;
This same synteny pattern is observed in a different gene in &#039;&#039;Xenopus&#039;&#039; on chromosome 1 (X.tropicalis NCBI ID:100491155, XB-GENEPAGE-29080546). Thus this gene (XB-GENEPAGE-941063) - now re-named &#039;&#039;lrrc19l&#039;&#039; (&amp;quot;leucine rich repeat containing 19 like&amp;quot;) gene in &#039;&#039;Xenopus&#039;&#039;- is instead flanked by the &#039;&#039;tie1&#039;&#039; and &#039;&#039;mpl&#039;&#039; genes on one side and &#039;&#039;tmem125&#039;&#039; and &#039;&#039;cfap57&#039;&#039; genes on the other side; This region was examined in humans, and while a syntenic locus was identified, the gene in that position did not blast or align well with this &#039;&#039;lrrc19l&#039;&#039; gene in &#039;&#039;Xenopus&#039;&#039;, suggesting it is not represented in humans.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
29OCT2024&lt;br /&gt;
&lt;br /&gt;
removed the human ORF,  C1orf210 as ortholog.&lt;br /&gt;
&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
NCBI still has C1orf210 GeeID:149466 listed as the ortholog for &#039;&#039;Xenopus lrrc19l&#039;&#039;genes, so I have put it back on the page.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29208844&amp;diff=55620</id>
		<title>XB-FEAT-29208844</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29208844&amp;diff=55620"/>
		<updated>2026-06-15T19:31:46Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=&amp;#039;&amp;#039;traf3ip2&amp;#039;&amp;#039;= This is the community wiki page for the &amp;#039;&amp;#039;traf3ip2&amp;#039;&amp;#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.  =nomenlcture changes= 15JUN2025  &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039; gene names wwas changed from &amp;#039;&amp;#039;traf3ip3.2, TRAF3 interacting protein 3 gene 2&amp;#039;&amp;#039; to &amp;#039;&amp;#039;traf3ip2, TRAF3 interacting protein 2&amp;#039;&amp;#039;  following human name of the predicted otholog.   This change is supported by Synteny.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;traf3ip2&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the &#039;&#039;traf3ip2&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenlcture changes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene names wwas changed from &#039;&#039;traf3ip3.2, TRAF3 interacting protein 3 gene 2&#039;&#039; to &#039;&#039;traf3ip2, TRAF3 interacting protein 2&#039;&#039;  following human name of the predicted otholog. &lt;br /&gt;
&lt;br /&gt;
This change is supported by Synteny.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-973578&amp;diff=55619</id>
		<title>XB-FEAT-973578</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-973578&amp;diff=55619"/>
		<updated>2026-06-15T19:01:06Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* unnamed */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;eif4e2&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;eif4e2&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gen symbol was changed from MGC89871 to &#039;&#039;eif4e2&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5720005&amp;diff=55618</id>
		<title>XB-FEAT-5720005</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5720005&amp;diff=55618"/>
		<updated>2026-06-15T18:55:21Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* unnamed */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;nfam1&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;nfam1&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase&lt;br /&gt;
&lt;br /&gt;
=nomenclature changes=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene symbol cganged from XB5720005 to &#039;&#039;nfam1&#039;&#039; following NCBI orthology updates.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55617</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55617"/>
		<updated>2026-06-15T18:46:02Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* glull */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=protein characterization=&lt;br /&gt;
According to EggNog protein homology groupings, these &#039;&#039;glull&#039;&#039; proteins are another copy of glutamate-ammonia ligase, and theres no reason to think they are not real &#039;glul&#039; paralogs, just not the true irtholog of human GLUL. As frog gene names follow human gene names, and in human it seems this gene is represented/matched ( however you want to say it) to a ncRNA, not a protein coding gene, Xenopus &#039;glull&#039; hasn&#039;t been officially named (by anyone except Xenbase) as yet.&lt;br /&gt;
&lt;br /&gt;
=Synteny and nomenclature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern.  LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase&#039;&#039;  are found on Chromosome 4. This is supported by synteny. These  &#039;&#039;glul&#039;&#039; genes previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904/glul&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55616</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55616"/>
		<updated>2026-06-15T18:25:26Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* glull */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Synteny and nomenclature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern.  LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase&#039;&#039;  are found on Chromosome 4. This is supported by synteny. These  &#039;&#039;glul&#039;&#039; genes previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904/glul&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-990052&amp;diff=55615</id>
		<title>XB-FEAT-990052</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-990052&amp;diff=55615"/>
		<updated>2026-06-15T18:24:57Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glul&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glul&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Synteny and nomenclature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern. LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase&#039;&#039;  are found on Chromosome 4. This is supported by synteny. These &#039;&#039;glul&#039;&#039; gene previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904/glul&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-990052&amp;diff=55614</id>
		<title>XB-FEAT-990052</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-990052&amp;diff=55614"/>
		<updated>2026-06-15T18:24:12Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=Synteny and nomenclature changes for &amp;#039;&amp;#039;Xenopus glul&amp;#039;&amp;#039; and &amp;#039;&amp;#039;glull&amp;#039;&amp;#039; genes= 15JUN2025  Note that there are 2 different &amp;#039;glutamate-ammonia ligase&amp;#039; genes in &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039;.   XB-GENEPAGE-5923224  &amp;#039;&amp;#039;glull, glutamate-ammonia ligase like&amp;#039;&amp;#039;, are found on Chromsome 8 in the following conserved gene pattern. LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &amp;#039;&amp;#039;&amp;#039;previously annotated as &amp;#039;&amp;#039;glul&amp;#039;&amp;#039;&amp;#039;&amp;#039;&amp;#039; , be changed to &amp;#039;&amp;#039;like&amp;#039;&amp;#039; status.  Xla.L: &amp;#039;&amp;#039;f...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=Synteny and nomenclature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern. LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase&#039;&#039;  are found on Chromosome 4. This is supported by synteny. These &#039;&#039;glul&#039;&#039; gene previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904/glul&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55612</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55612"/>
		<updated>2026-06-15T18:22:53Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* Synteny and nomenclature changes for Xenopus glul and glull genes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Synteny and nomenclature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern.  LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase&#039;&#039;  are found on Chromosome 4. This is supported by synteny. These  &#039;&#039;glul&#039;&#039; genes previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904/glul&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55611</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55611"/>
		<updated>2026-06-15T18:22:04Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* Syntenty and nomenlcature changes for Xenopus glul and glull genes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Synteny and nomenclature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern.  LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase&#039;&#039;  are found on Chromosome 4. This is supported by synteny. these gene previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904/glul&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55610</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55610"/>
		<updated>2026-06-15T18:20:59Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* Syntenty and nomenlcature changes for Xenopus glul and glull genes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Syntenty and nomenlcature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern.  LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase&#039;&#039;  are found on Chromosome 4. This is supported by synteny. these gene previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904/glul&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55607</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55607"/>
		<updated>2026-06-15T18:19:23Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* Syntenty and nomenlcature changes for Xenopus glul and glull genes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Syntenty and nomenlcature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern.  LACK of Synteny with human mouse chick and/or rat necessitate that these gene names/symbols, &#039;&#039;&#039;previously annotated as &#039;&#039;glul&#039;&#039;&#039;&#039;&#039; , be changed to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase like 1&#039;&#039;  are found on Chromosome 4. This is supported by synteny. these gene previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul-like .1.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul-like .1 .S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904 /glul-like .1&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55604</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55604"/>
		<updated>2026-06-15T18:16:27Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* Syntenty in Xenopus */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Syntenty and nomenlcature changes for &#039;&#039;Xenopus glul&#039;&#039; and &#039;&#039;glull&#039;&#039; genes=&lt;br /&gt;
15JUN2025&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glull, glutamate-ammonia ligase like&#039;&#039;, are found on Chromsome 8 in the following conserved gene pattern. LACK of Synteny with human mouse chick and/or rat necessitate that these genes, previously annoated as &#039;&#039;glul&#039;&#039; bechanged to &#039;&#039;like&#039;&#039; status.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glull.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glull.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257/gllull [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 TRUE GLUL orthologs , named &#039;&#039;glul,  glutamate-ammonia ligase like 1&#039;&#039;  are found on Chromosome 4. This is supported by synteny. these gene previously had the &#039;&#039;like&#039;&#039; status. &lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul-like .1.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul-like .1 .S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904 /glul-like .1&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55603</id>
		<title>XB-FEAT-5923224</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-5923224&amp;diff=55603"/>
		<updated>2026-06-15T18:11:45Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* glul */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;glull&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;glull&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=Syntenty in &#039;&#039;Xenopus&#039;&#039;=&lt;br /&gt;
9.13/2021&lt;br /&gt;
&lt;br /&gt;
Note that there are 2 different &#039;glutamate-ammonia ligase&#039; genes in &#039;&#039;Xenopus&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-5923224  &#039;&#039;glul, glutamate-ammonia ligase&#039;&#039;, is found on Chromsome 8 in the following conserved gene pattern.&lt;br /&gt;
&lt;br /&gt;
Xla.L: &#039;&#039;fcn2&amp;gt; ...nelfb.L&amp;gt; ... LOC108698160&amp;gt; Xelaev18038263m&amp;gt; ... &#039;&#039;&#039;glul.L&#039;&#039;&#039;&amp;gt; ...  arrdc1.L&amp;gt; ... ehmt1.L&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S:  &#039;&#039;LOC108699888 [prov:fcn2] LOC108700639 [provl:glul]&amp;gt; ... &#039;&#039;&#039;glul.S&#039;&#039;&#039;&amp;gt; ...arrdc1.S&amp;gt; ... ehmt1.S&amp;gt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
X.trop: &#039;&#039;fcn2l &amp;gt; ...  nelfb &amp;gt; ... LOC116406908&amp;lt; ... LOC100498257 [glutamine synthetase] &amp;gt;  ... &#039;&#039;&#039;glul&#039;&#039;&#039;&amp;gt;  ... arrdc1&amp;gt; ... ehmt1&#039;&#039;&amp;gt;&lt;br /&gt;
&lt;br /&gt;
 XB-GENEPAGE-990052 &#039;&#039;glul-like.1,  glutamate-ammonia ligase like 1&#039;&#039;  is found on Chromosome 4.&lt;br /&gt;
&lt;br /&gt;
Xla.L: d&#039;&#039;hx9.L&amp;lt; .. npl.L&amp;lt; ... rgs8.L&amp;gt; ... rgs16.L&amp;gt; ... &#039;&#039;&#039;glul-like .1.L&#039;&#039;&#039; &amp;gt;  LOC108713540 [provisional:zfp989.L]&amp;gt; ... cacna1e.L&amp;lt;&#039;&#039; &lt;br /&gt;
&lt;br /&gt;
Xla.S: &#039;&#039;dhx9.S&amp;lt; .. npl.S&amp;lt; ... rgs8.S&amp;gt; ... rgs16.S&amp;gt; ... &#039;&#039;&#039;glul-like .1 .S&#039;&#039;&#039;&amp;gt;  Xelaev18025342m.S&amp;gt; ... LOC108715639/cacna1e.S&amp;lt;&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
Xtrop: &#039;&#039;dhx9&amp;lt; .. npl&amp;lt; ... rgs8&amp;gt; ... rgs16&amp;gt; ... &#039;&#039;&#039;LOC394904 /glul-like .1&#039;&#039;&#039; &amp;gt;  znf91&amp;gt; ... cacna1e&amp;lt;&#039;&#039;&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55602</id>
		<title>XB-FEAT-29098406</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55602"/>
		<updated>2026-06-15T17:40:04Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= &#039;&#039;adrb1&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the gene&#039;&#039;adrb1&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene symbol changed from &#039;&#039;adrb1l&#039;&#039; to &#039;&#039;adrb1&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name changed from &#039;&#039;adrenoceptor beta 1 like&#039;&#039; to &#039;&#039;adrenoceptor beta 1&#039;&#039;. &lt;br /&gt;
&lt;br /&gt;
These changes are supported by synteny, and follow NCBI and Xenbase orthology predictions.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6034587&amp;diff=55601</id>
		<title>XB-FEAT-6034587</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6034587&amp;diff=55601"/>
		<updated>2026-06-15T17:31:29Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* adrb1 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;adrb4cl&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;adrb4cl&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus tropicalis&#039;&#039; gene symbol changed from &#039;&#039;adrb1l&#039;&#039; to &#039;&#039;adrb1&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus tropicalis&#039;&#039; gene name changed from &#039;&#039;adrenoceptor beta 1 like&#039;&#039; to &#039;&#039;adrenoceptor beta 1&#039;&#039;. &lt;br /&gt;
&lt;br /&gt;
These changes are supported by synteny, and follow NCBI and Xenbase orthology predictions.&lt;br /&gt;
&lt;br /&gt;
True ADRB1 orthologs in &#039;&#039;Xenopus&#039;&#039; are on Chromosome 7/7L7S. &lt;br /&gt;
&lt;br /&gt;
The protein this gene encodes is annoated as a  adrenergic receptor beta 4c type in X.laevis and is poorl;y characterisedin X. trop  The Chr 3 gene in Xtrop (GeneDI:100487086 on XB-GENEPAGE-29098406) was referred to as &#039;&#039;adrb1- &#039;like&#039;&#039;&#039; gene, but sysnteny shows it is is a paralog of the X.laevis.L gene. &lt;br /&gt;
&lt;br /&gt;
We&#039;ve put them on the same XB gene page and provisionally called them &#039;&#039;adrb4cl/ adrb4c-like&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6034587&amp;diff=55600</id>
		<title>XB-FEAT-6034587</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6034587&amp;diff=55600"/>
		<updated>2026-06-15T17:31:19Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* adrb1 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;adrb1&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;adrb1&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus tropicalis&#039;&#039; gene symbol changed from &#039;&#039;adrb1l&#039;&#039; to &#039;&#039;adrb1&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus tropicalis&#039;&#039; gene name changed from &#039;&#039;adrenoceptor beta 1 like&#039;&#039; to &#039;&#039;adrenoceptor beta 1&#039;&#039;. &lt;br /&gt;
&lt;br /&gt;
These changes are supported by synteny, and follow NCBI and Xenbase orthology predictions.&lt;br /&gt;
&lt;br /&gt;
True ADRB1 orthologs in &#039;&#039;Xenopus&#039;&#039; are on Chromosome 7/7L7S. &lt;br /&gt;
&lt;br /&gt;
The protein this gene encodes is annoated as a  adrenergic receptor beta 4c type in X.laevis and is poorl;y characterisedin X. trop  The Chr 3 gene in Xtrop (GeneDI:100487086 on XB-GENEPAGE-29098406) was referred to as &#039;&#039;adrb1- &#039;like&#039;&#039;&#039; gene, but sysnteny shows it is is a paralog of the X.laevis.L gene. &lt;br /&gt;
&lt;br /&gt;
We&#039;ve put them on the same XB gene page and provisionally called them &#039;&#039;adrb4cl/ adrb4c-like&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55599</id>
		<title>XB-FEAT-29098406</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55599"/>
		<updated>2026-06-15T17:15:58Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* nomenclature updates */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= &#039;&#039;adrb1l&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the gene&#039;&#039;adrb1&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55598</id>
		<title>XB-FEAT-29098406</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55598"/>
		<updated>2026-06-15T17:15:18Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* adrb1 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= &#039;&#039;adrb1l&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the gene&#039;&#039;adrb1&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene symbol changed from &#039;&#039;adrb1l&#039;&#039; to &#039;&#039;adrb1&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name changed from &#039;&#039;adrenoceptor beta 1 like&#039;&#039; to &#039;&#039;adrenoceptor beta 1&#039;&#039;. &lt;br /&gt;
&lt;br /&gt;
These changes are supported by synteny, and follow NCBI and Xenbase orthology predictions.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55597</id>
		<title>XB-FEAT-29098406</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29098406&amp;diff=55597"/>
		<updated>2026-06-15T17:06:21Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;= &amp;#039;&amp;#039;adrb1&amp;#039;&amp;#039;= This is the community wiki page for the gene&amp;#039;&amp;#039;adrb1&amp;#039;&amp;#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.  =nomenclature updates= 15JUN2026  &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039; gene symbol changed from &amp;#039;&amp;#039;adrb1l&amp;#039;&amp;#039; to &amp;#039;&amp;#039;adrb1&amp;#039;&amp;#039;  &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039; gene name changed from &amp;#039;&amp;#039;adrenoceptor beta 1 like&amp;#039;&amp;#039; to &amp;#039;&amp;#039;adrenoceptor beta 1&amp;#039;&amp;#039;.   These changes are supported by synteny, and follow NCBI and Xenbase orthology predictions.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= &#039;&#039;adrb1&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the gene&#039;&#039;adrb1&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
15JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene symbol changed from &#039;&#039;adrb1l&#039;&#039; to &#039;&#039;adrb1&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name changed from &#039;&#039;adrenoceptor beta 1 like&#039;&#039; to &#039;&#039;adrenoceptor beta 1&#039;&#039;. &lt;br /&gt;
&lt;br /&gt;
These changes are supported by synteny, and follow NCBI and Xenbase orthology predictions.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-484087&amp;diff=55596</id>
		<title>XB-FEAT-484087</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-484087&amp;diff=55596"/>
		<updated>2026-06-15T17:06:06Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* nomenclature changes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;pax6&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;pax6&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature changes=&lt;br /&gt;
&lt;br /&gt;
HGNC records previous name as: AN2, &amp;quot;paired box gene 6 (aniridia, keratitis)&amp;quot; .&lt;br /&gt;
&lt;br /&gt;
HGNC records Synonyms as:   AN, &amp;quot;aniridia, keratitis&amp;quot;, D11S812E, WAGR&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-484087&amp;diff=55595</id>
		<title>XB-FEAT-484087</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-484087&amp;diff=55595"/>
		<updated>2026-06-15T17:05:48Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* pax6 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;pax6&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;pax6&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature changes=&lt;br /&gt;
HGNC records previous name as: AN2, &amp;quot;paired box gene 6 (aniridia, keratitis)&amp;quot;  &lt;br /&gt;
HGNC records Synonyms as:   AN, &amp;quot;aniridia, keratitis&amp;quot;, D11S812E, WAGR&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55594</id>
		<title>XB-FEAT-6049135</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55594"/>
		<updated>2026-06-09T13:06:48Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* X. tropicalis proteein FASTA */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;uckl1b&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;uckl1b&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=name changes=&lt;br /&gt;
07JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name and symbol changed from &#039;&#039;uckl1, uridine-cytidine kinase 1-like 1&#039;&#039; to &#039;&#039;uckl1b, uridine-cytidine kinase 1-like 1b&#039;&#039; following orthology assessent and synteny by NCBi and Xenbase. &lt;br /&gt;
&lt;br /&gt;
TRUE UCKL1 orthologs are on Chr 10/9_10L  in &#039;&#039;Xenopus&#039;&#039;, while these &#039;&#039;uckl1 &#039;b&#039;&#039;&#039; genes are on chr 5, 5L and 5S.&lt;br /&gt;
&lt;br /&gt;
The X.trop protein (below) does still hit the UCKL1 homology group,in EggNog5.0,  so they are still annotated correctly to the best of our knowledge.  &lt;br /&gt;
&lt;br /&gt;
=X&#039;&#039;. tropicalis&#039;&#039; proteein FASTA=&lt;br /&gt;
&amp;gt;uridine-cytidine kinase-like 1 [Xenopus tropicalis]&lt;br /&gt;
 &lt;br /&gt;
MESGTGEKDGDPGRARARSDSGEDSLETLLTRLPLTPSLSPRKRTTSQSKTEPPL&lt;br /&gt;
LRTSKRTIYTAGRPPWYNESGTPFKEAFVIGLCGGSASGKTTVANKIIEALDVPW&lt;br /&gt;
VVLLSMDCFYKILSKEEQDLAARNEYNFDHPDAFDFDLLVNVVRKLKKGKSVKVP&lt;br /&gt;
VYDFTTHSRRKEWKTIYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVR&lt;br /&gt;
RLKRDITERGRDIVGVIKQYNKFVKPAFEQYIEPTVQLADIVVPRGGENFVALDL&lt;br /&gt;
IVQHVHSQLEKRMQRWDMAALASAHQGQPLPDTLSVLLSTPQVRGMHTIIRNKDT&lt;br /&gt;
NRDEFIFYSKRLMRLLIEHALSFLPLSPVTVETPQGSLYQGKRFHRQRLTGVSI&lt;br /&gt;
LRAGETMEQALMAVCKDIRLGKILIQTNHNTGEPELHYLRLPKEISEDYVILMDS&lt;br /&gt;
TVSTGAAAMMAIRVLLDHDVQEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVD&lt;br /&gt;
&lt;br /&gt;
KRVNQEFHIIPGIGNFGDRFFGTDAPSDWHESDDFSMDY&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55593</id>
		<title>XB-FEAT-6049135</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55593"/>
		<updated>2026-06-09T13:06:17Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* X. tropicalis proteein FASTA */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;uckl1b&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;uckl1b&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=name changes=&lt;br /&gt;
07JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name and symbol changed from &#039;&#039;uckl1, uridine-cytidine kinase 1-like 1&#039;&#039; to &#039;&#039;uckl1b, uridine-cytidine kinase 1-like 1b&#039;&#039; following orthology assessent and synteny by NCBi and Xenbase. &lt;br /&gt;
&lt;br /&gt;
TRUE UCKL1 orthologs are on Chr 10/9_10L  in &#039;&#039;Xenopus&#039;&#039;, while these &#039;&#039;uckl1 &#039;b&#039;&#039;&#039; genes are on chr 5, 5L and 5S.&lt;br /&gt;
&lt;br /&gt;
The X.trop protein (below) does still hit the UCKL1 homology group,in EggNog5.0,  so they are still annotated correctly to the best of our knowledge.  &lt;br /&gt;
&lt;br /&gt;
=X&#039;&#039;. tropicalis&#039;&#039; proteein FASTA=&lt;br /&gt;
&amp;gt;uridine-cytidine kinase-like 1 [Xenopus tropicalis]&lt;br /&gt;
 &lt;br /&gt;
MESGTGEKDGDPGRARARSDSGEDSLETLLTRLPLTPSLSPRKRTTSQSKTEPPL&lt;br /&gt;
LRTSKRTIYTAGRPPWYNESGTPFKEAFVIGLCGGSASGKTTVANKIIEALDVPW&lt;br /&gt;
VVLLSMDCFYKILSKEEQDLAARNEYNFDHPDAFDFDLLVNVVRKLKKGKSVKVP&lt;br /&gt;
VYDFTTHSRRKEWKTIYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVR&lt;br /&gt;
RLKRDITERGRDIVGVIKQYNKFVKPAFEQYIEPTVQLADIVVPRGGENFVALDL&lt;br /&gt;
IVQHVHSQLEKRMQRWDMAALASAHQGQPLPDTLSVLLSTPQVRGMHTIIRNKDT&lt;br /&gt;
NRDEFIFYSKRLMRLLIEHALSFLPLSPVTVETPQGSLYQGKRFHRQRLTGVSI&lt;br /&gt;
LRAGETMEQALMAVCKDIRLGKILIQTNHNTGEPELHYLRLPKEISEDYVILMDS&lt;br /&gt;
TVSTGAAAMMAIRVLLDHDVQEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVD&lt;br /&gt;
KRVNQEFHIIPGIGNFGDRFFGTDAPSDWHESDDFSMDY&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55592</id>
		<title>XB-FEAT-6049135</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55592"/>
		<updated>2026-06-08T21:13:37Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* name changes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;uckl1b&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;uckl1b&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=name changes=&lt;br /&gt;
07JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name and symbol changed from &#039;&#039;uckl1, uridine-cytidine kinase 1-like 1&#039;&#039; to &#039;&#039;uckl1b, uridine-cytidine kinase 1-like 1b&#039;&#039; following orthology assessent and synteny by NCBi and Xenbase. &lt;br /&gt;
&lt;br /&gt;
TRUE UCKL1 orthologs are on Chr 10/9_10L  in &#039;&#039;Xenopus&#039;&#039;, while these &#039;&#039;uckl1 &#039;b&#039;&#039;&#039; genes are on chr 5, 5L and 5S.&lt;br /&gt;
&lt;br /&gt;
The X.trop protein (below) does still hit the UCKL1 homology group,in EggNog5.0,  so they are still annotated correctly to the best of our knowledge.  &lt;br /&gt;
&lt;br /&gt;
=X&#039;&#039;. tropicalis&#039;&#039; proteein FASTA=&lt;br /&gt;
&amp;gt;uridine-cytidine kinase-like 1 [Xenopus tropicalis] &lt;br /&gt;
MESGTGEKDGDPGRARARSDSGEDSLETLLTRLPLTPSLSPRKRTTSQSKTEPPL&lt;br /&gt;
LRTSKRTIYTAGRPPWYNESGTPFKEAFVIGLCGGSASGKTTVANKIIEALDVPW&lt;br /&gt;
VVLLSMDCFYKILSKEEQDLAARNEYNFDHPDAFDFDLLVNVVRKLKKGKSVKVP&lt;br /&gt;
VYDFTTHSRRKEWKTIYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVR&lt;br /&gt;
RLKRDITERGRDIVGVIKQYNKFVKPAFEQYIEPTVQLADIVVPRGGENFVALDL&lt;br /&gt;
IVQHVHSQLEKRMQRWDMAALASAHQGQPLPDTLSVLLSTPQVRGMHTIIRNKDT&lt;br /&gt;
NRDEFIFYSKRLMRLLIEHALSFLPLSPVTVETPQGSLYQGKRFHRQRLTGVSI&lt;br /&gt;
LRAGETMEQALMAVCKDIRLGKILIQTNHNTGEPELHYLRLPKEISEDYVILMDS&lt;br /&gt;
TVSTGAAAMMAIRVLLDHDVQEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVD&lt;br /&gt;
KRVNQEFHIIPGIGNFGDRFFGTDAPSDWHESDDFSMDY&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55591</id>
		<title>XB-FEAT-6049135</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55591"/>
		<updated>2026-06-08T21:11:53Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* name changes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;uckl1b&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;uckl1b&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=name changes=&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name and symbol changed from &#039;&#039;uckl1, uridine-cytidine kinase 1-like 1&#039;&#039; to &#039;&#039;uckl1b, uridine-cytidine kinase 1-like 1b&#039;&#039; follwoing orthology assessent and synteny. TRUE UCKL1 orthologs are on Chr 10/9_10L  in &#039;&#039;Xenopus&#039;&#039;, while these &#039;b&#039; genes are on chr 5, 5L and 5S.&lt;br /&gt;
&lt;br /&gt;
THe X.trop protein (below) does still hit the UCKL1 homology group, so they are still annotated correctly.  &lt;br /&gt;
&lt;br /&gt;
&amp;gt;uridine-cytidine kinase-like 1 [Xenopus tropicalis] &lt;br /&gt;
MESGTGEKDGDPGRARARSDSGEDSLETLLTRLPLTPSLSPRKRTTSQSKTEPPL&lt;br /&gt;
LRTSKRTIYTAGRPPWYNESGTPFKEAFVIGLCGGSASGKTTVANKIIEALDVPW&lt;br /&gt;
VVLLSMDCFYKILSKEEQDLAARNEYNFDHPDAFDFDLLVNVVRKLKKGKSVKVP&lt;br /&gt;
VYDFTTHSRRKEWKTIYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVR&lt;br /&gt;
RLKRDITERGRDIVGVIKQYNKFVKPAFEQYIEPTVQLADIVVPRGGENFVALDL&lt;br /&gt;
IVQHVHSQLEKRMQRWDMAALASAHQGQPLPDTLSVLLSTPQVRGMHTIIRNKDT&lt;br /&gt;
NRDEFIFYSKRLMRLLIEHALSFLPLSPVTVETPQGSLYQGKRFHRQRLTGVSI&lt;br /&gt;
LRAGETMEQALMAVCKDIRLGKILIQTNHNTGEPELHYLRLPKEISEDYVILMDS&lt;br /&gt;
TVSTGAAAMMAIRVLLDHDVQEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVD&lt;br /&gt;
KRVNQEFHIIPGIGNFGDRFFGTDAPSDWHESDDFSMDY&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55590</id>
		<title>XB-FEAT-6049135</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6049135&amp;diff=55590"/>
		<updated>2026-06-08T21:11:22Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* uckl1 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;uckl1b&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;uckl1b&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=name changes=&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name and symbol changed from &#039;&#039;uckl1, uridine-cytidine kinase 1-like 1&#039;&#039; to &#039;&#039;uckl1b, uridine-cytidine kinase 1-like 1b&#039;&#039; follwoing orthology assessent and synteny. TRUE UCKL1 orthologs are on Chr 10/9_10L  in &#039;&#039;Xenopus&#039;&#039;, while these &#039;b&#039; genes are on chr 5, 5L and 5S.&lt;br /&gt;
&lt;br /&gt;
THe X.trop protein (below) does still hit the UCKL1 homology group, so they are still annotated correctly.  &lt;br /&gt;
&lt;br /&gt;
&amp;gt;uridine-cytidine kinase-like 1 [Xenopus tropicalis] &lt;br /&gt;
MESGTGEKDGDPGRARARSDSGEDSLETLLTRLPLTPSLSPRKRTTSQSKTEPPLLRTSKRTIYTAGRPPWYNESGTPFKEAFVIGLCGGSASGKTTVANKIIEALDVPWVVLLSMDCFYKILSKEEQDLAARNEYNFDHPDAFDFDLLVNVVRKLKKGKSVKVPVYDFTTHSRRKEWKTIYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVRRLKRDITERGRDIVGVIKQYNKFVKPAFEQYIEPTVQLADIVVPRGGENFVALDLIVQHVHSQLEKRMQRWDMAALASAHQGQPLPDTLSVLLSTPQVRGMHTIIRNKDTNRDEFIFYSKRLMRLLIEHALSFLPLSPVTVETPQGSLYQGKRFHRQRLTGVSILRAGETMEQALMAVCKDIRLGKILIQTNHNTGEPELHYLRLPKEISEDYVILMDSTVSTGAAAMMAIRVLLDHDVQEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNQEFHIIPGIGNFGDRFFGTDAPSDWHESDDFSMDY&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29093614&amp;diff=55589</id>
		<title>XB-FEAT-29093614</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29093614&amp;diff=55589"/>
		<updated>2026-06-08T21:03:28Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=&amp;#039;&amp;#039;uckl1&amp;#039;&amp;#039;= This is the community wiki page for the &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039; &amp;#039;&amp;#039;uckl1&amp;#039;&amp;#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;uckl1&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus&#039;&#039; &#039;&#039;uckl1&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29089362&amp;diff=55588</id>
		<title>XB-FEAT-29089362</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29089362&amp;diff=55588"/>
		<updated>2026-06-08T20:50:46Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* tmem88 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;tmem88&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus tmem88&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
07JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene symbols was changed from &#039;&#039;LOC105946942&#039;&#039; to &#039;&#039;tmem88&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29089362&amp;diff=55587</id>
		<title>XB-FEAT-29089362</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29089362&amp;diff=55587"/>
		<updated>2026-06-08T20:49:41Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=&amp;#039;&amp;#039;tmem88&amp;#039;&amp;#039;= This is the community wiki page for the &amp;#039;&amp;#039;Xenopus tmem88&amp;#039;&amp;#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;tmem88&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus tmem88&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-486800&amp;diff=55586</id>
		<title>XB-FEAT-486800</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-486800&amp;diff=55586"/>
		<updated>2026-06-08T20:37:41Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* pax2 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;pax2&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus&#039;&#039; &#039;&#039;pax2&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-486800&amp;diff=55585</id>
		<title>XB-FEAT-486800</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-486800&amp;diff=55585"/>
		<updated>2026-06-08T20:37:25Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* pax2 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;pax2&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the &#039;&#039;Xenopus&#039;&#039;&#039;&#039;pax2&#039;&#039; genes. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087262&amp;diff=55584</id>
		<title>XB-FEAT-29087262</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087262&amp;diff=55584"/>
		<updated>2026-06-08T20:36:42Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* nomenclature updates */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= &#039;&#039;nt5dc2&#039;&#039; =&lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;nt5dc2&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
07JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039; Xenopus&#039;&#039; gene symbol changed from LOC101733834 to &#039;&#039;nt5dc2&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087262&amp;diff=55583</id>
		<title>XB-FEAT-29087262</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29087262&amp;diff=55583"/>
		<updated>2026-06-08T20:36:26Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;= &amp;#039;&amp;#039;nt5dc2&amp;#039;&amp;#039; = This is the community wiki page for the gene &amp;#039;&amp;#039;nt5dc2&amp;#039;&amp;#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.  =nomenclature updates= 07JUn2026  &amp;#039;&amp;#039; Xenopus&amp;#039;&amp;#039; gene symbol changed from LOC101733834 to &amp;#039;&amp;#039;nt5dc2&amp;#039;&amp;#039;.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= &#039;&#039;nt5dc2&#039;&#039; =&lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;nt5dc2&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
07JUn2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039; Xenopus&#039;&#039; gene symbol changed from LOC101733834 to &#039;&#039;nt5dc2&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29082638&amp;diff=55582</id>
		<title>XB-FEAT-29082638</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29082638&amp;diff=55582"/>
		<updated>2026-06-08T19:05:50Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=&amp;#039;&amp;#039;c6h7orf78&amp;#039;&amp;#039;= This is the community wiki page for the gene &amp;#039;&amp;#039;c6h7orf78&amp;#039;&amp;#039;. Feel free to add any information here that is relevant to this gene that is not already captured elsewhere on Xenbase.  =nomenclature updates= 07JUn2026  &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039; gene name was changed from LOC100495274 (uncharacterized) to &amp;#039;&amp;#039;c6h7orf78, chromosme 6 C7orf78 homolog&amp;#039;&amp;#039; based on NCBI orthology and synteny analysis.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;c6h7orf78&#039;&#039;=&lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;c6h7orf78&#039;&#039;. Feel free to add any information here that is relevant to this gene that is not already captured elsewhere on Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
07JUn2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name was changed from LOC100495274 (uncharacterized) to &#039;&#039;c6h7orf78, chromosme 6 C7orf78 homolog&#039;&#039; based on NCBI orthology and synteny analysis.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-961587&amp;diff=55581</id>
		<title>XB-FEAT-961587</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-961587&amp;diff=55581"/>
		<updated>2026-06-08T18:58:23Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* nomenclature updates */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;has1l&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;has1l&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
7JUN2026 &lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;Xenopus has1&#039;&#039; and &#039;&#039;has1l&#039;&#039; genes were mis-annotated in v10 assemblies. We have changed the gene names and gene symbols based on NCBI orthology predictions, which are supported by synteny, as follows:&lt;br /&gt;
&lt;br /&gt;
Former &#039;&#039;has1l&#039;&#039; is now &#039;&#039;has1&#039;&#039; and now has HAS1 orthologs on XB-GENEPAGE-22062959&lt;br /&gt;
&lt;br /&gt;
Former &#039;&#039;has1&#039;&#039; is now &#039;&#039;has1l&#039;&#039; and HAS1 orthologs have been removed from XB-GENEPAGE-961587&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-22062959&amp;diff=55580</id>
		<title>XB-FEAT-22062959</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-22062959&amp;diff=55580"/>
		<updated>2026-06-08T18:58:21Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* nomenclature updates */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;has1&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;has1&#039;&#039; . Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
7JUN2026 &lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;Xenopus has1&#039;&#039; and &#039;&#039;has1l&#039;&#039; genes were mis-annotated in v10 assemblies. We have changed the gene names and gene symbols based on NCBI orthology predictions, which are supported by synteny, as follows:&lt;br /&gt;
&lt;br /&gt;
Former &#039;&#039;has1l&#039;&#039; is now &#039;&#039;has1&#039;&#039; and now has HAS1 orthologs on XB-GENEPAGE-22062959&lt;br /&gt;
&lt;br /&gt;
Former &#039;&#039;has1&#039;&#039; is now &#039;&#039;has1l&#039;&#039; and HAS1 orthologs have been removed from XB-GENEPAGE-961587&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-961587&amp;diff=55579</id>
		<title>XB-FEAT-961587</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-961587&amp;diff=55579"/>
		<updated>2026-06-08T18:56:36Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* has1 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;has1l&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;has1l&#039;&#039;. Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
7JUN2026 &lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;Xenopus has1&#039;&#039; and &#039;&#039;has1l&#039;&#039; genes were mis-annotated in v10 assemblies. We have changed the gene names and gene symbols based on NCBI orthology predictions, which are supported by synteny, as follows:&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;has1l&#039;&#039; is now &#039;&#039;has1&#039;&#039; and now has HAS1 orthologs&lt;br /&gt;
&#039;&#039;has1&#039;&#039; is now &#039;&#039;has1l&#039;&#039; and HAS1 orthologs have been removed.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-22062959&amp;diff=55578</id>
		<title>XB-FEAT-22062959</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-22062959&amp;diff=55578"/>
		<updated>2026-06-08T18:56:29Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=&amp;#039;&amp;#039;has1&amp;#039;&amp;#039;=  This is the community wiki page for the gene &amp;#039;&amp;#039;has1&amp;#039;&amp;#039; . Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.  =nomenclature updates= 7JUN2026   The &amp;#039;&amp;#039;Xenopus has1&amp;#039;&amp;#039; and &amp;#039;&amp;#039;has1l&amp;#039;&amp;#039; genes were mis-annotated in v10 assemblies. We have changed the gene names and gene symbols based on NCBI orthology predictions, which are supported by synteny, as follows:  &amp;#039;&amp;#039;has1l&amp;#039;&amp;#039; is now &amp;#039;&amp;#039;has1&amp;#039;&amp;#039; and now has HAS1...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;has1&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;has1&#039;&#039; . Please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
7JUN2026 &lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;Xenopus has1&#039;&#039; and &#039;&#039;has1l&#039;&#039; genes were mis-annotated in v10 assemblies. We have changed the gene names and gene symbols based on NCBI orthology predictions, which are supported by synteny, as follows:&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;has1l&#039;&#039; is now &#039;&#039;has1&#039;&#039; and now has HAS1 orthologs&lt;br /&gt;
&#039;&#039;has1&#039;&#039; is now &#039;&#039;has1l&#039;&#039; and HAS1 orthologs have been removed.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29080162&amp;diff=55577</id>
		<title>XB-FEAT-29080162</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29080162&amp;diff=55577"/>
		<updated>2026-06-08T18:25:15Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* wdr55 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;wdr55&#039;&#039;=&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
7JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name was updated for LOC100490380 &amp;amp; LOC108710859 to &#039;&#039;wdr55, WD repeat domain 55&#039;&#039; after orthology and synteny analysis.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29080162&amp;diff=55576</id>
		<title>XB-FEAT-29080162</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-29080162&amp;diff=55576"/>
		<updated>2026-06-08T18:25:07Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: Created page with &amp;quot;=wdr55= =nomenclature updates= 7JUN2026  &amp;#039;&amp;#039;Xenopus&amp;#039;&amp;#039; gene name was updated for LOC100490380 &amp;amp; LOC108710859 to &amp;#039;&amp;#039;wdr55, WD repeat domain 55&amp;#039;&amp;#039; after orthology and synteny analysis.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=wdr55=&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
7JUN2026&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;Xenopus&#039;&#039; gene name was updated for LOC100490380 &amp;amp; LOC108710859 to &#039;&#039;wdr55, WD repeat domain 55&#039;&#039; after orthology and synteny analysis.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55575</id>
		<title>XB-FEAT-6455941</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55575"/>
		<updated>2026-06-08T18:21:00Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* wdr55 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;wdr55l&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;wdr55l&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
07JUNE2026&lt;br /&gt;
&lt;br /&gt;
Although the LOC780073 protein accessions [http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=protein&amp;amp;val=KAE8614012] do match the WDR55 homology group according to EggNogg5.0. &lt;br /&gt;
&lt;br /&gt;
Syteny also predicts that the &#039;&#039;Xtrop&#039;&#039; model LOC100490380 and the &#039;&#039;X. laevis&#039;&#039; model LOC100490380.L are the true WDR55 orthologs, and NCBI also asserts LOC100490380/.L as the true orthologs.&lt;br /&gt;
&lt;br /&gt;
THe gene name and symbol are therefore updated to &#039;&#039;wdr55l&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55574</id>
		<title>XB-FEAT-6455941</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55574"/>
		<updated>2026-06-08T18:20:46Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* nomenclature updates */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;wdr55&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;wdr55&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
07JUNE2026&lt;br /&gt;
&lt;br /&gt;
Although the LOC780073 protein accessions [http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=protein&amp;amp;val=KAE8614012] do match the WDR55 homology group according to EggNogg5.0. &lt;br /&gt;
&lt;br /&gt;
Syteny also predicts that the &#039;&#039;Xtrop&#039;&#039; model LOC100490380 and the &#039;&#039;X. laevis&#039;&#039; model LOC100490380.L are the true WDR55 orthologs, and NCBI also asserts LOC100490380/.L as the true orthologs.&lt;br /&gt;
&lt;br /&gt;
THe gene name and symbol are therefore updated to &#039;&#039;wdr55l&#039;&#039;.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55573</id>
		<title>XB-FEAT-6455941</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55573"/>
		<updated>2026-06-08T18:19:00Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* wdr55 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;wdr55&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;wdr55&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase&lt;br /&gt;
&lt;br /&gt;
=nomenclature updates=&lt;br /&gt;
07JUNE2026&lt;br /&gt;
&lt;br /&gt;
Although the LOC780073 protein accessions do match the WDR55 homology group, syteny predicts that the &#039;&#039;Xtrop&#039;&#039; model LOC100490380 and the &#039;&#039;X. laevis&#039;&#039; model LOC100490380.L are the true WDR55 orthologs. &lt;br /&gt;
&lt;br /&gt;
NCBI also asserts LOC100490380/.L as the true orthologs.&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
	<entry>
		<id>https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55572</id>
		<title>XB-FEAT-6455941</title>
		<link rel="alternate" type="text/html" href="https://wiki.xenbase.org/xenwiki/index.php?title=XB-FEAT-6455941&amp;diff=55572"/>
		<updated>2026-06-08T18:13:52Z</updated>

		<summary type="html">&lt;p&gt;Xenbase: /* wdr55 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=&#039;&#039;wdr55&#039;&#039;= &lt;br /&gt;
This is the community wiki page for the gene &#039;&#039;wdr55&#039;&#039; please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase&lt;/div&gt;</summary>
		<author><name>Xenbase</name></author>
	</entry>
</feed>