XB-FEAT-22063310 - Revision history

Xenbase: /* orthology */

2025-03-10T16:23:16Z

orthology

← Older revision		Revision as of 16:23, 10 March 2025
Line 21:		Line 21:

	DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.		DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.

	~~Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)~~

Xenbase: /* protein used in DIOPT analysis */

2025-03-10T16:22:50Z

protein used in DIOPT analysis

← Older revision		Revision as of 16:22, 10 March 2025
Line 22:		Line 22:
	DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.		DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.

	Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)		Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)

	~~=protein used in DIOPT analysis=~~
	~~dentin sialophosphoprotein-like [Xenopus tropicalis]~~

	~~NCBI Reference Sequence: XP_031746799.1~~

	~~>XP_031746799.1 dentin sialophosphoprotein-like [Xenopus tropicalis]~~
	~~MKLILGLLVLFPWTLRAQDNQMVTSNDSDITTGVNSEQQTDASNSTSDQGSYNNTYNTLTTGSDSYTTET~~
	~~AAADAPTDSSDPLPTNSSSYNTDGNMLENKDALLVTSVNNNVLESTVMSSSPTSTDSGTYSTAESTVYSL~~
	~~SKSEGDSASEDQSNENSNSMESEQGDTSCAVYEILREAGMVGYRGLSAADWICVLKMTNLFHPSEKNAVR~~
	~~CRNLKSHKAKYSCECFGDNVHKYIQCQMKTMRDPTDLWNQFCNGKDLSQYTRACESQLPQEPRKY~~


	~~this makes no sense to me - CJZ~~

Xenbase: /* nomenclature changes */

2025-03-10T16:22:34Z

nomenclature changes

← Older revision		Revision as of 16:22, 10 March 2025
Line 8:		Line 8:

	''Xenopus'' gene symbol changed from ''spaca5'' to ''spaca5.2''. Synteny support the other ''spaca5'' gene on chr 8 as the true ortholog of the human SPACA5 gene.		''Xenopus'' gene symbol changed from ''spaca5'' to ''spaca5.2''. Synteny support the other ''spaca5'' gene on chr 8 as the true ortholog of the human SPACA5 gene.

			10MARCH2025

			There were 4 genes annotated as 'spaca5' and 'spaca5l' in the v10 ''Xenopus'' genome assemblies.

			Synteny supports the 2 gene models on Chr8/8L/8S, as the true orthologs of the human SPACA5 gene.

			The names of the ''spaca5'' genes on chr10/9_10L have been changed to 'spaca5-like' genes 1 and 2.

	=orthology=		=orthology=

Christina: /* protein used in DIOPT analysis */

2025-03-07T19:56:38Z

protein used in DIOPT analysis

← Older revision		Revision as of 19:56, 7 March 2025
Line 26:		Line 26:
	SKSEGDSASEDQSNENSNSMESEQGDTSCAVYEILREAGMVGYRGLSAADWICVLKMTNLFHPSEKNAVR		SKSEGDSASEDQSNENSNSMESEQGDTSCAVYEILREAGMVGYRGLSAADWICVLKMTNLFHPSEKNAVR
	CRNLKSHKAKYSCECFGDNVHKYIQCQMKTMRDPTDLWNQFCNGKDLSQYTRACESQLPQEPRKY		CRNLKSHKAKYSCECFGDNVHKYIQCQMKTMRDPTDLWNQFCNGKDLSQYTRACESQLPQEPRKY


			this makes no sense to me - CJZ

Christina: /* nomenclature changes */

2025-03-07T19:55:03Z

nomenclature changes

← Older revision		Revision as of 19:55, 7 March 2025
Line 4:		Line 4:

	''Xenopus'' gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to ''spaca5, sperm acrosome associated 5''		''Xenopus'' gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to ''spaca5, sperm acrosome associated 5''

			08MARCH20205

			''Xenopus'' gene symbol changed from ''spaca5'' to ''spaca5.2''. Synteny support the other ''spaca5'' gene on chr 8 as the true ortholog of the human SPACA5 gene.

	=orthology=		=orthology=

Christina: /* orthology */

2023-04-26T18:27:11Z

orthology

← Older revision		Revision as of 18:27, 26 April 2023
Line 9:		Line 9:

	DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.		DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.

			Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)

			=protein used in DIOPT analysis=
			dentin sialophosphoprotein-like [Xenopus tropicalis]

			NCBI Reference Sequence: XP_031746799.1

			>XP_031746799.1 dentin sialophosphoprotein-like [Xenopus tropicalis]
			MKLILGLLVLFPWTLRAQDNQMVTSNDSDITTGVNSEQQTDASNSTSDQGSYNNTYNTLTTGSDSYTTET
			AAADAPTDSSDPLPTNSSSYNTDGNMLENKDALLVTSVNNNVLESTVMSSSPTSTDSGTYSTAESTVYSL
			SKSEGDSASEDQSNENSNSMESEQGDTSCAVYEILREAGMVGYRGLSAADWICVLKMTNLFHPSEKNAVR
			CRNLKSHKAKYSCECFGDNVHKYIQCQMKTMRDPTDLWNQFCNGKDLSQYTRACESQLPQEPRKY

Christina: /* NOMENCLATURE CHANGES */

2023-04-26T18:25:49Z

NOMENCLATURE CHANGES

← Older revision		Revision as of 18:25, 26 April 2023
Line 1:		Line 1:

	=~~NOMENCLATURE CHANGES~~=		=nomenclature changes=
	26April2023		26April2023

Christina: Created page with " =NOMENCLATURE CHANGES= 26April2023 ''Xenopus'' gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to ''spaca5, sperm acrosome a..."

2023-04-26T18:24:19Z

Created page with " =NOMENCLATURE CHANGES= 26April2023 ''Xenopus'' gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to ''spaca5, sperm acrosome a..."

New page

=NOMENCLATURE CHANGES=
26April2023

''Xenopus'' gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to ''spaca5, sperm acrosome associated 5''

=orthology=
26April2023

DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.