XB-FEAT-29082798 - Revision history

Xenbase: /* nomenclature updates */

2026-05-26T15:06:56Z

nomenclature updates

← Older revision		Revision as of 15:06, 26 May 2026
Line 9:		Line 9:
	The protein for the tropicalis gene matches the NAT16 homology group in >70 species ( using EggNog5.0) with very high confidence, and the protein has already been characterised at a nat16 ortholog.		The protein for the tropicalis gene matches the NAT16 homology group in >70 species ( using EggNog5.0) with very high confidence, and the protein has already been characterised at a nat16 ortholog.

	There are ~~several~~ duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',		There are numerous duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 312' in the series for ''X. tropicalis'', which will be the appropriate number in the series relative to gene order, for this N-acetyltransferase gene/protein in ''X. tropicalis''.

	=protein for ''Xtr.nat16.12''=		=protein for ''Xtr.nat16.12''=

Xenbase: /* protein for Xtr.nat16.3 */

2026-05-26T15:05:24Z

protein for Xtr.nat16.3

← Older revision		Revision as of 15:05, 26 May 2026
Line 11:		Line 11:
	There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',		There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',

	=protein for ''Xtr.nat16.3''=		=protein for ''Xtr.nat16.12''=
	probable N-acetyltransferase 16 [Xenopus tropicalis]		probable N-acetyltransferase 16 [Xenopus tropicalis]
	NCBI Reference Sequence: XP_031755365.1		NCBI Reference Sequence: XP_031755365.1

Xenbase: /* nat16.3 */

2026-05-26T15:04:56Z

nat16.3

← Older revision		Revision as of 15:04, 26 May 2026
Line 1:		Line 1:
	=''nat16.3''=		=''nat16.12''=

	=nomenclature updates=		=nomenclature updates=

Xenbase: /* protein for Xtr.nat16.3 */

2026-05-26T14:01:40Z

protein for Xtr.nat16.3

← Older revision		Revision as of 14:01, 26 May 2026
Line 11:		Line 11:
	There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',		There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',

	=protein for Xtr.nat16.3''=		=protein for ''Xtr.nat16.3''=
	probable N-acetyltransferase 16 [Xenopus tropicalis]		probable N-acetyltransferase 16 [Xenopus tropicalis]
	NCBI Reference Sequence: XP_031755365.1		NCBI Reference Sequence: XP_031755365.1

Xenbase: /* nomenclature updates */

2026-05-26T14:01:29Z

nomenclature updates

← Older revision		Revision as of 14:01, 26 May 2026
Line 10:		Line 10:

	There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',		There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',

			=protein for Xtr.nat16.3''=
			probable N-acetyltransferase 16 [Xenopus tropicalis]
			NCBI Reference Sequence: XP_031755365.1
			GenPept Identical Proteins Graphics
			>XP_031755365.1 probable N-acetyltransferase 16 [Xenopus tropicalis]
			MHSEPPEVVSLHLENMSENPLPDAQILPATARDYKEVMSISKGIYCGADPLPSRYHEWLADPKREMFVAK
			SEGKVVGFMSFLLVDDGTTAVAEALRVAPWMRGRGIAGAIQQFSLDFLRSNYPGATRIRFSGTSETPPTI
			MSRCRKVHSKSLISVVIPYEQMEEKIKLLEGRLEGVGGRRLPVALSPSEVLRLFEDPCTTERLLPKGLLI
			QSWFPLSTHRSNLELLRQRGVVWLYSQPSASISEICTGTHDSPYTPQEPSAPIPLSLPISSSLPNPSIVS
			HTSCGFLSLGTPPFPVPLGDGMCRFDIDLFGTDPVSAQSHVLHQLIEMQRVLPAGGGAVCYLFAETSLFP
			ELNQFCQGLEPFYKVIEQHVLEIEV

Xenbase: /* nomenclature updates */

2026-05-26T14:00:48Z

nomenclature updates

← Older revision		Revision as of 14:00, 26 May 2026
Line 5:		Line 5:
	25MAY2026		25MAY2026

	"'Xenopus'' gene symbol and name were updated, changing from ''LOC100495706, probable N-acetyltransferase 16'' to ''nat16.3, N-acetyltransferase 16 gene 3''.		''Xenopus'' gene symbol and name were updated, changing from ''LOC100495706, probable N-acetyltransferase 16'' to ''nat16.3, N-acetyltransferase 16 gene 3''.

	The protein for the tropicalis gene matches the NAT16 homology group in >70 species ( using EggNog5.0) with very high confidence, and the protein has already been characterised at a nat16 ortholog.		The protein for the tropicalis gene matches the NAT16 homology group in >70 species ( using EggNog5.0) with very high confidence, and the protein has already been characterised at a nat16 ortholog.

	There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',		There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',

Xenbase: Created page with "=''nat16.3''= =nomenclature updates= 25MAY2026 "'Xenopus'' gene symbol and name were updated, changing from ''LOC100495706, probable N-acetyltransferase 16'' to ''nat16.3, N-acetyltransferase 16 gene 3''. The protein for the tropicalis gene matches the NAT16 homology group in >70 species ( using EggNog5.0) with very high confidence, and the protein has already been characterised at a nat16 ortholog. There are several duplicates of ''nat16'' in ''Xenopus'', all on c..."

2026-05-26T14:00:21Z

Created page with "=''nat16.3''= =nomenclature updates= 25MAY2026 "'Xenopus'' gene symbol and name were updated, changing from ''LOC100495706, probable N-acetyltransferase 16'' to ''nat16.3, N-acetyltransferase 16 gene 3''. The protein for the tropicalis gene matches the NAT16 homology group in >70 species ( using EggNog5.0) with very high confidence, and the protein has already been characterised at a nat16 ortholog. There are several duplicates of ''nat16'' in ''Xenopus'', all on c..."

New page

=''nat16.3''=

=nomenclature updates=

25MAY2026

"'Xenopus'' gene symbol and name were updated, changing from ''LOC100495706, probable N-acetyltransferase 16'' to ''nat16.3, N-acetyltransferase 16 gene 3''.

The protein for the tropicalis gene matches the NAT16 homology group in >70 species ( using EggNog5.0) with very high confidence, and the protein has already been characterised at a nat16 ortholog.

There are several duplicates of ''nat16'' in ''Xenopus'', all on chr 3, separated only by a string of "histidine N-acetyltransferase" and "histidine N-acetyltransferase- like" gene models. As no gene symbol can be immediately applied to this latter genes, I am skipping them and naming this gene model 'gene 3' in the series for ''X. tropicalis'',