XB-FEAT-22068624: Difference between revisions

From XenWiki
Jump to navigation Jump to search
(Created page with "= ''fndc3c1l'' = This is the community wiki page for the gene ''fndc3c1l'' please feel free to add any information that is relevant to this gene that is not already captured...")
(No difference)

Revision as of 14:43, 4 January 2023

fndc3c1l

This is the community wiki page for the gene fndc3c1l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

04JAN2023 name changes based on provisional analysis of protein sequence below:

gene name updated /changed from fibroin heavy chain-like to fibronectin type III domain containing 3C1 like

gene symbol changed from XB22068624 to fndc3c1l


orthology analysis

04JAN2023 NCBI Reference Sequence: XP_031755143.1, uncharacterized protein LOC101733873 [Xenopus tropicalis]

protein sequence used:

MRDTNNKWLIYKNGGLYAKELNNANLHLRAPIEVTTYGSLVTVNLNISSITEILPNSSIADCLPCTSVTESLPNSSIADCLPCTSVTESL PNSSIADCLPCTSVTESLPNSSIADCLPCTSVTESLPNSSITNCLPCTSVTESWPCNLITESRHYIALTESRHCIALTESLHNSSITDCL PNSSITDSLPNSSITESLSITESLSALYIAFSILDTNSQKRIFLYSSSGTLEYKKLDAIPPSVSGDNVNLLFSTTQQTHTATYVPINYSQ CTLCTSQRADQSLSLQNTIRNDFIRDFYLQDV

DIOPTs EggNoggtool, which searches protien sequences to determine orthology groups, gives only a few results for LOC101733873, grouping this protein with Fndc3c1 and Fnd3c2 (fibronectin type III domain containing 3C1) in Mouse and rat and 24 other species ( not all accession had gene symbols).

Functionally, Mouse fndc3c1 is 'predicted to be integral component of membrane'.

Note that NCBI has 982 genes/proteins with this 'fibroin heavy chain-like ' name, but all have loc# symbols; fibrobrin is a silk protein in moths, FIBH, so thats the insect gene.