XB-FEAT-22166267: Difference between revisions

From XenWiki
Jump to navigation Jump to search
 
(3 intermediate revisions by the same user not shown)
Line 3: Line 3:
This is the community wiki page for the gene ''wdr88l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
This is the community wiki page for the gene ''wdr88l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.


=nomenlcature changes=
=nomenclature changes=
04JAN2023
04JAN2023
gene name changed from  ''loc100145065'' to ''WD repeat domain 88 like''
gene name changed from  ''loc100145065'' to ''WD repeat domain 88 like''


gene symbol changed from ''XB22166267'' to ''wdr88l''
gene symbol changed from ''XB22166267'' to ''wdr88l''


both gene name and symbols are given provisional staus tags, as teh identity is uncertain.
both gene name and symbols are given provisional staus tags, as their identity is still uncertain.


=Protein sequence=
=Protein sequence=
Line 17: Line 18:
GRPRNQEGGKCPEKKPVVHGPRNSRGLRRSLRIKKFAARYSS
GRPRNQEGGKCPEKKPVVHGPRNSRGLRRSLRIKKFAARYSS


This partial sequence contains a Myb/SANT-like DNA-binding domain, and when entered into the DIOPT EggNogg tool, is close homolog to ''Xenopus'' wdr88 gene, and 2 other sequemces ( weak evidence at best). Thus the gene is provisonally named ''wdr88 like''
This partial sequence contains a Myb/SANT-like DNA-binding domain, and when entered into the DIOPT EggNogg tool, is close homolog to ''Xenopus'' wdr88 gene, and 2 other sequences ( weak evidence at best). Thus the gene is provisonally named ''wdr88 like''

Latest revision as of 10:51, 25 April 2023

wdr88l

This is the community wiki page for the gene wdr88l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

04JAN2023

gene name changed from loc100145065 to WD repeat domain 88 like

gene symbol changed from XB22166267 to wdr88l

both gene name and symbols are given provisional staus tags, as their identity is still uncertain.

Protein sequence

LSSKVAARKFPSVPSQETPSRMDQELTDGSVGRAWTPQETQAMLDLIRDLGLGPALTRKGYQNWDVFERLQVLLSHCRVRASSAEIKAQW QALKMKFWRLKRFVGLAPLVAITADFPFYQQMEQLLEPQKRMEICSREADSTIQESGRPTSSLSDSPSDEDMTDDASIPEVHHEQEPAIN NGGNLHPENVQEAAPQDGAAIRNPHLAPEALADLEPEPIRLLQTTMGQLVEGMAQLVQTLNRVCGVQEQISIQLGYFCSLLPKFPIQMGS GRPRNQEGGKCPEKKPVVHGPRNSRGLRRSLRIKKFAARYSS

This partial sequence contains a Myb/SANT-like DNA-binding domain, and when entered into the DIOPT EggNogg tool, is close homolog to Xenopus wdr88 gene, and 2 other sequences ( weak evidence at best). Thus the gene is provisonally named wdr88 like