XB-FEAT-22167168: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Created page with "=rchy1.2= This is the community wiki page for the ''Xenopus'' gene ''rchy1.2''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase...."
 
 
(3 intermediate revisions by the same user not shown)
Line 1: Line 1:
=rchy1.2=
=''rchy1l''=


This is the community wiki page for the ''Xenopus'' gene ''rchy1.2''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase.
This is the community wiki page for the ''Xenopus'' gene ''rchy1l''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase.


=nomenclature changes=
=nomenclature changes=
04JAN2023
04JAN2023


gene name was changed from ''XB22167168'' to ''ring finger and CHY zinc finger domain containing 1 gene 2''
gene name was changed from ''XB22167168'' to ''ring finger and CHY zinc finger domain containing 1 like''


gene synbol was changed from ''uncharacterized XB22167168'' to ''rchy1.2''
gene synbol was changed from ''uncharacterized XB22167168'' to ''rchy1l''


Using the DIOPT Eggnog tool the protein from this gene found on ''Xenopus'' Chr3/3L (v10 genome assemblies) matches '''Rchy1''' ''ring finger and CHY zinc finger domain containing 1'' in 447 species with high confidence. True RCHY1 orthologs are however  the genes on Chr1/1L. This gene will therefore be provisionally named ''rchy1.2''
Using the DIOPT Eggnog tool the protein from this gene found on ''Xenopus'' Chr3/3L (v10 genome assemblies) matches '''Rchy1''' ''ring finger and CHY zinc finger domain containing 1'' in 447 species with high confidence. True RCHY1 orthologs are however  the genes on Chr1/1L. This gene will therefore be provisionally named ''rchy1l''


==protein sequence for ''X. tropicalis rchy1.2'' used in orthology group analysis=
==protein sequence for ''X. tropicalis rchy1l'' used in orthology group analysis=
MAEGQVQSVKVPPVNEDGVTCSQEKFHRQQPQHLCKFFSQGRYCRFGNRCRFLHQLAECQNSEKNRKQNVSCKLTEKSNATAISCSPNNS
MAEGQVQSVKVPPVNEDGVTCSQEKFHRQQPQHLCKFFSQGRYCRFGNRCRFLHQLAECQNSEKNRKQNVSCKLTEKSNATAISCSPNNS
FSDPVKKGLGSHQRKYQPRKLCRYFASGFCAMENHCKFWHPDNHPPINDGHPQDKKAAATSTVVRMPVERPQALPESLRFGDVTLDMAKK
FSDPVKKGLGSHQRKYQPRKLCRYFASGFCAMENHCKFWHPDNHPPINDGHPQDKKAAATSTVVRMPVERPQALPESLRFGDVTLDMAKK

Latest revision as of 11:29, 25 April 2023

rchy1l

This is the community wiki page for the Xenopus gene rchy1l. Feel free to note here anything about rchy1.2 that is not recorded elsewhere on Xenbase.

nomenclature changes

04JAN2023

gene name was changed from XB22167168 to ring finger and CHY zinc finger domain containing 1 like

gene synbol was changed from uncharacterized XB22167168 to rchy1l

Using the DIOPT Eggnog tool the protein from this gene found on Xenopus Chr3/3L (v10 genome assemblies) matches Rchy1 ring finger and CHY zinc finger domain containing 1 in 447 species with high confidence. True RCHY1 orthologs are however the genes on Chr1/1L. This gene will therefore be provisionally named rchy1l

=protein sequence for X. tropicalis rchy1l used in orthology group analysis

MAEGQVQSVKVPPVNEDGVTCSQEKFHRQQPQHLCKFFSQGRYCRFGNRCRFLHQLAECQNSEKNRKQNVSCKLTEKSNATAISCSPNNS FSDPVKKGLGSHQRKYQPRKLCRYFASGFCAMENHCKFWHPDNHPPINDGHPQDKKAAATSTVVRMPVERPQALPESLRFGDVTLDMAKK LRETEISQLLKRFPKDKVIVQEREDGEVTYYRVTVEPTDPDWPFDLKEMEIMLEFPDDYPLKVFTVQIPEDQDLPPVMCRHVREASLTWL EAKHATNQLIGKVELLFRPYLHWLDRNMERLFTEGARLLKRDVDAEKAGIEFVPYQQLQALVIESSCDKSARETVTQNNPEDPPDESLEE DSDDWTSCDDDDDDDELEPGPDDRMKSIEGGGTEAPKKGTEIRFLGLKLGEDVGTLMAHCISVSLQCNRCQTIADLSVSGRQPCTAQCDR CNSRISGAFHPRVIHQFSAVLGYVDIQGASPKDLILQDCDFIFSCLSCSQEGQVQSLSYGIPKDLNCLHCHCKLSISVEATKFQKVERCP AKIIGSKGLLNQGRKRAVKDPSIQPGKPLPDHGTCRHYRKSCRWLRFPCCGKAYPCDVCHDDAEDHEMELASRMICGYCAKEQAYTNGKP CTSCGNMMSKGLHSGHWEGGRGCRNKVKMSRKDKQKYANSSKTVSRRSVSKF