XB-FEAT-952622: Difference between revisions

From XenWiki
Jump to navigation Jump to search
imported>Xenbase gene generator
No edit summary
 
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
=unnamed=  
=''tex49''=  
This is the community wiki page for the gene ''unnamed'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
This is the community wiki page for the gene ''tex49'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
 
=nomenclature changes=
25April2023
 
The name of this gene was changed to tex49, testis-expressed protein 49 following review of orthology and synteny.
 
=protein=
testis-expressed protein 49 [Xenopus tropicalis]
NCBI Reference Sequence: XP_002935150.2
 
>XP_002935150.2 testis-expressed protein 49 [Xenopus tropicalis]
MAFFGLTHLGYQDPLRALSLQGNGQAAASGQTAVYGKHEESHIKLPALVPQSPYVSHGKYQEMRRRHQDL
RTPKQTQRMPATSAQQYGWWLPQDPRSKAESVHPWIGCQRYPQISSPMTLFVQQMYLTDKSFRLF
 
This protein is identical to 39 proteins/species tex49 genes, according to a DIOPT/EggNog analysis which aligns proteins to pre-calculated homology groups, supporting the above gene nomenclature change.

Latest revision as of 07:18, 26 April 2023

tex49

This is the community wiki page for the gene tex49 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase

nomenclature changes

25April2023

The name of this gene was changed to tex49, testis-expressed protein 49 following review of orthology and synteny.

protein

testis-expressed protein 49 [Xenopus tropicalis] NCBI Reference Sequence: XP_002935150.2

>XP_002935150.2 testis-expressed protein 49 [Xenopus tropicalis] MAFFGLTHLGYQDPLRALSLQGNGQAAASGQTAVYGKHEESHIKLPALVPQSPYVSHGKYQEMRRRHQDL RTPKQTQRMPATSAQQYGWWLPQDPRSKAESVHPWIGCQRYPQISSPMTLFVQQMYLTDKSFRLF

This protein is identical to 39 proteins/species tex49 genes, according to a DIOPT/EggNog analysis which aligns proteins to pre-calculated homology groups, supporting the above gene nomenclature change.