XB-FEAT-22068108: Difference between revisions

From XenWiki
Jump to navigation Jump to search
 
Line 1: Line 1:




=''c4h3orf62'' =
This is the community wiki page for the ''Xenopus c4h3orf62'' genes. Feel free to record anything here that is not represented elsewhere on Xenbase.


= nomenclature changes =  
= nomenclature changes =  

Latest revision as of 14:29, 25 May 2023


c4h3orf62

This is the community wiki page for the Xenopus c4h3orf62 genes. Feel free to record anything here that is not represented elsewhere on Xenbase.

nomenclature changes

5DEC2022

HGNC and NCBIs RefSeq team have recently renamed all non-human open reading frame (ORF) genes. The new Xenopus gene symbol syntax reflects the orthology to the human gene while starting with a prefix indictating location of the ORF on the Xenopus chromosome, i.e., the Xenopus chromosome number (c#), then 'h#' for the human chromosome number, then the same human 'orf #'. Old human 'c'orf' gene symbols are recorded as synonyms.

orthology inference from protein sequence

the Xtrop protein accession XP_031756970.1 matches C3orf62 genes in DIOPT/EggNog Orthologs group, with 67 proteins in 67 species, incluidng Anolis carolinensis 28377.ENSACAP00000007824 C3orf62; Otolemur garnettii 30611.ENSOGAP00000001669 C3orf62; Pteropus vampyrus 132908.ENSPVAP00000008242 C3orf62; Monodelphis domestica 13616.ENSMODP00000016265 C3orf62; Pongo abelii 9601.ENSPPYP00000015524 C3orf62; Homo sapiens 9606.ENSP00000341139 C3orf62; an dCanis lupus 9612.ENSCAFP00000017130 C3orf62.

So I'm confodent this uncharacterised LO geen is the Xtropicalis C3orf62 ortholog!

protein accession FASTA

uncharacterized protein LOC116410455 [Xenopus tropicalis]

NCBI Reference Sequence: XP_031756970.1


>XP_031756970.1 uncharacterized protein LOC116410455 [Xenopus tropicalis] MSEKLRRCRKEFSEAISRVLENSGLPYFIHLHAYHYPAGYMKSVPTKSIVCENVVTMPFCVQLHMIPEHP FSHPPEAKRPGQHSLSLDLEQTPQSSISSFTDSQEDITGTLLELIESTNYRVMAKTYETVESEVDLSILY GLCPGSPSYGATMPLVSKKAAADASAVPAPLTDEEDCRIIEMVLDMEEDYCCQTQTCAHLT