XB-FEAT-29089970: Difference between revisions
(Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...") |
(No difference)
|
Latest revision as of 08:23, 14 July 2023
pkn2l.8
This is the community wiki page for the Xenopus pkn2l.8 genes. Please feel free to add any information here, that is relevant to these genes and is not already captured elsewhere in Xenbase.
nomenclature changes
13 JULY 2023 Xenopus gene symbol was updated from LOC105948302 to pkn2l.8
Xenopus gene named was updated from protein kinase C, brain isozyme-like to protein kinase N2 like gene 8
This name update was informed by BLASTp, Synteny, and a DIOPT/EggNog homology-group analysis of the protein accession.
- BLASTp matches it to pkn2l.5/LOC100489050 (98% identical). BLASTp also matches to LOC108648302 and LOC101731755 (94% identical to both) however these 2 records has been withdrawn by NCBI because the model on which it was based was not predicted in a later annotation.all other matches are from archived genomes/genes
- DIOPT matched this gene with a large homology group of ~600 proteins from >200 species, which in vertebrates are called AKT1 AKT2 and AKT3 (including seqs from X. tropicalis with genes annotated as akt1 and akt2). NB: AKT genes are also serine/threonine kinases
- Synteny: this unnamed gene is in a long string of duplicated 'pkn2-like' genes on X. tropicalis chr8.
RefSeq protein for LOC105948302
>XP_012825317.2 protein kinase C, brain isozyme-like [Xenopus tropicalis] MNQPVGTPLYKAPEVYEARPYTRSVDWWALGAMIYKMVVGHPPFLANTLKDLALMVTEAPVMYTKAIPRQ TRNIIEGLLMKNGSCRLGSSANGAEDVAAHPFFSTIDWNALKKKHVRPPFIPKPCGKCTAEEQISIQTPP HLIMHLSRGVQEAFDEFCESAEGKSSVKEAAVEFHDTDDSSSLDSESCEELRDLAEDSNSAQEPVEEVSS LCCCCRPTFL
orthology
note that true orthologs of human PKN2 are found on chromosome 4, while this string of tandemly duplicates of Xenopus pkn2 -like genes are on chromosome 8.