XB-FEAT-959836: Difference between revisions
imported>Xenbase gene generator No edit summary |
|||
(6 intermediate revisions by 2 users not shown) | |||
Line 1: | Line 1: | ||
= | = ''ifit5l''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''ifit5l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | ||
=Nomenclature changes= | |||
19AUG2022 | |||
Gene symbol changed from "''XB959836 [provisional:ifit5]''" to "''ifit5 (provisional)''". | |||
"XB959836" was added as a gene synonym. | |||
Gene name changed from "provisional ortholog of interferon induced protein with tetratricopeptide repeats 5" to "interferon induced protein with tetratricopeptide repeats 5 (provisional)". | |||
14 JULY 2023 | |||
''(provisional)'' removed from the gene name and symbol, and ''like'' suffix added. | |||
the true identifty of this gene is still to be determined. | |||
=orthology= | |||
DIOPT/EggNog analysis of the protein below, matches the vertebrate homology group for OGT and TTC13 genes/proteins, incluing those in ''Xenopus tropicalis''. | |||
Note that ''ttc13 (tetratricopeptide repeat domain 13 )'' is found on ''Xenopus'' Chr5/5L/5S. ans Xenopus ''ogt' genes are on Chr8/8L, so ''ifit5l' is not/not likely a tandem/duplicate of those genes. | |||
=protein accession= | |||
interferon-induced protein with tetratricopeptide repeats 5 [Xenopus tropicalis] | |||
NCBI Reference Sequence: XP_031761761.1 | |||
>XP_031761761.1 interferon-induced protein with tetratricopeptide repeats 5 [Xenopus tropicalis] | |||
MSDLPAESIKNHLLKLECHFTWAFFKDETDIDNIEDRLHDQITFLPSTHRDRLHNLLAYTSYLKGDTQEA | |||
IRQLQKAEEHLQGTQTAHLDIKRAVTYSNYAWLYYHSNQFSKTQFYLKKVEAICKKFESSPEHDILLTER | |||
YGEQAWALLTLYGKYCERAKECFEKGLVLDPDNPELNSGYATVMYRIESQHNRDYGTADCTSLELLKRAV | |||
TLNEDDTVIKALLALKYAYLFQAEEGEKVMEEALRQTPDSPYLLRYAAKFYRIVKKTDDAITILKKAINQ | |||
TPTSCSLHHQIGICYKEKTKMLIKSARTAKSLNQPTNAYTRDKGDAIASAIFHFEKAIELKKIFVDAYIN | |||
LGYMYAKASQFEKAEDMFQRALNLENITCEEKQEIHLSYAVFKQFQMRSESEAIRHYKEALLIPNNTKAR | |||
RFSKSDLEKLAEKKISTAPSDATGFGLLGFIYQQDGEIKQATDYYKKALERDPDNEDYLSALRCMRLSE |
Latest revision as of 09:14, 14 July 2023
ifit5l
This is the community wiki page for the gene ifit5l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
Nomenclature changes
19AUG2022
Gene symbol changed from "XB959836 [provisional:ifit5]" to "ifit5 (provisional)".
"XB959836" was added as a gene synonym.
Gene name changed from "provisional ortholog of interferon induced protein with tetratricopeptide repeats 5" to "interferon induced protein with tetratricopeptide repeats 5 (provisional)".
14 JULY 2023
(provisional) removed from the gene name and symbol, and like suffix added.
the true identifty of this gene is still to be determined.
orthology
DIOPT/EggNog analysis of the protein below, matches the vertebrate homology group for OGT and TTC13 genes/proteins, incluing those in Xenopus tropicalis.
Note that ttc13 (tetratricopeptide repeat domain 13 ) is found on Xenopus Chr5/5L/5S. ans Xenopus ogt' genes are on Chr8/8L, so ifit5l' is not/not likely a tandem/duplicate of those genes.
protein accession
interferon-induced protein with tetratricopeptide repeats 5 [Xenopus tropicalis]
NCBI Reference Sequence: XP_031761761.1
>XP_031761761.1 interferon-induced protein with tetratricopeptide repeats 5 [Xenopus tropicalis]
MSDLPAESIKNHLLKLECHFTWAFFKDETDIDNIEDRLHDQITFLPSTHRDRLHNLLAYTSYLKGDTQEA
IRQLQKAEEHLQGTQTAHLDIKRAVTYSNYAWLYYHSNQFSKTQFYLKKVEAICKKFESSPEHDILLTER
YGEQAWALLTLYGKYCERAKECFEKGLVLDPDNPELNSGYATVMYRIESQHNRDYGTADCTSLELLKRAV
TLNEDDTVIKALLALKYAYLFQAEEGEKVMEEALRQTPDSPYLLRYAAKFYRIVKKTDDAITILKKAINQ
TPTSCSLHHQIGICYKEKTKMLIKSARTAKSLNQPTNAYTRDKGDAIASAIFHFEKAIELKKIFVDAYIN
LGYMYAKASQFEKAEDMFQRALNLENITCEEKQEIHLSYAVFKQFQMRSESEAIRHYKEALLIPNNTKAR
RFSKSDLEKLAEKKISTAPSDATGFGLLGFIYQQDGEIKQATDYYKKALERDPDNEDYLSALRCMRLSE