XB-FEAT-1008884: Difference between revisions
imported>Xenbase gene generator No edit summary |
|||
| Line 1: | Line 1: | ||
=cdipt= | =''cdipt''= | ||
This is the community wiki page for the gene ''cdipt'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | This is the community wiki page for the gene ''cdipt'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | ||
=gene model annotation and nomeclature= | |||
18SEPT2023 | |||
Based on synteny and orthology predictions, the ''X. laevis'' ''cdipt.L'' gene has been identified as ''MGC81124'', aka 'uncharacterized protein LOC414725 [Xenopus laevis] using this protein sequence" | |||
NCBI Reference Sequence: NP_001084752.1', | |||
>NP_001084752.1 uncharacterized protein LOC414725 [Xenopus laevis] | |||
MAQENVFLFVPNLIGYARIVFAFLAFYFMPTSPIMASTFYLLSGLLDAFDGHAARLLNQGTKFGAMLDML | |||
TDRCATMCLLVNLSLLYPSYTLLFQLSMSLDIASHWLHLHSSILKGSESHKTINLAGNPVLRLYYTSRPV | |||
LFFMCAGNELFYCMLYLLHFTEGPSVILGPIGAVGLFRLIVWLCCPISLLKSLISLIHLVTASSNIASLD | |||
CAERSKKK | |||
Note that the v10 genome annotation had mislabeled the ''cdipt.S''gene model as ''cdipt.L'', and thus the v10 model was incorrectly placed under the L homolog in this gene page, this has now been corrected , and the gene models will soon be in the correct position, and correctly named. | |||
''X. tropicalis'' ''cdipt'': GeneID: 779827 | |||
''X. laevis'' ''cdipt.L'': GeneID: 414725. [LOC414725 and MGC81124 recorded as synonyms] | |||
''X. laevis'' ''cdipt.S'': GeneID: 443837 | |||
Latest revision as of 09:06, 18 September 2023
cdipt
This is the community wiki page for the gene cdipt please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
gene model annotation and nomeclature
18SEPT2023
Based on synteny and orthology predictions, the X. laevis cdipt.L gene has been identified as MGC81124, aka 'uncharacterized protein LOC414725 [Xenopus laevis] using this protein sequence"
NCBI Reference Sequence: NP_001084752.1',
>NP_001084752.1 uncharacterized protein LOC414725 [Xenopus laevis] MAQENVFLFVPNLIGYARIVFAFLAFYFMPTSPIMASTFYLLSGLLDAFDGHAARLLNQGTKFGAMLDML TDRCATMCLLVNLSLLYPSYTLLFQLSMSLDIASHWLHLHSSILKGSESHKTINLAGNPVLRLYYTSRPV LFFMCAGNELFYCMLYLLHFTEGPSVILGPIGAVGLFRLIVWLCCPISLLKSLISLIHLVTASSNIASLD CAERSKKK
Note that the v10 genome annotation had mislabeled the cdipt.Sgene model as cdipt.L, and thus the v10 model was incorrectly placed under the L homolog in this gene page, this has now been corrected , and the gene models will soon be in the correct position, and correctly named.
X. tropicalis cdipt: GeneID: 779827
X. laevis cdipt.L: GeneID: 414725. [LOC414725 and MGC81124 recorded as synonyms]
X. laevis cdipt.S: GeneID: 443837