XB-FEAT-5843935: Difference between revisions
imported>Xenbase gene generator No edit summary |
|||
| (One intermediate revision by the same user not shown) | |||
| Line 1: | Line 1: | ||
=unnamed= | =unnamed= | ||
This is the community wiki page for the gene ''unnamed'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | This is the community wiki page for the gene ''unnamed'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=nomenclature changes= | |||
16MAY2023 | |||
''Xenopus'' gene name changed from ''XB5843935 [provisional:kctd12], provisional ortholog of potassium channel tetramerization domain containing 12'' to ''kctd12l, potassium channel tetramerization domain containing 12'' | |||
=synteny & orthology= | |||
16MAY2023 | |||
'''Synteny does NOT support this gene as the true ortholog of the human KCTD12''', so we will provisionally call it a like gene: | |||
Human chr13: MYCBP2> FBXL3> CLN5> ACOD>1 '''KCTD12'''< LMO7< UCHL3< COMMD6> TBC1D4> | |||
XTROPCHR8: cmc4> dkc1> rbmx2< loc< loc< '''XB5843935>'''(run through) znf5354 | |||
Mouse: Slc25a14> Gpr119> Rbmx2> Gm7770> Fsip2l< Enox2< Arhgap36> Or11q2 | |||
=orthogy= | |||
DIOPT/EggNog analaysis of the Xtrop protein [XP_017951589.1] matches it with > 1700 proteins in >200 species as a KDTD gene family. | |||
Including these Mouse genes:Kctd4, Kctd14, Kctd19, Kctd12, Kctd7, Kctd16, Kctd15, Kcnrg, Kctd1, Kctd11, Kctd18, Kctd12b, Kctd6, Kctd21, Kctd8. | |||
Further analaysi is required to best name this gene in ''Xenopus'', so for now we will call it a Kctd12-like gene. | |||
>XP_017951589.1 uncharacterized protein LOC100124783 isoform X1 [Xenopus tropicalis] | |||
MALADHTSCIRQGEELPPFPDIIELNVGGQVYITRYPTLVSVPGSLLSEMFSQRNSRPLARDSKGRYFLD | |||
RDGFLFRYVLDYMRDQQLVLPDHFPERLRLQREAEFFRLPELVKILAPKVSKQNSIGDDAFQSDSEEQSP | |||
NVEVARNLASVSAALAAAAGNQSTMSDLRRSGFITIGYRGSYTLGRDSQTDAKFRRVARIMVCGKTSLAK | |||
EVFGDTLNDSRDPDRPPERYTSRYYLKFTFLEQAFDRLADAGFHMVACNSTGTCAFAHDQTDDKIWTSYT | |||
EYVFYRE | |||
Latest revision as of 11:07, 16 May 2023
unnamed
This is the community wiki page for the gene unnamed please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
16MAY2023
Xenopus gene name changed from XB5843935 [provisional:kctd12], provisional ortholog of potassium channel tetramerization domain containing 12 to kctd12l, potassium channel tetramerization domain containing 12
synteny & orthology
16MAY2023
Synteny does NOT support this gene as the true ortholog of the human KCTD12, so we will provisionally call it a like gene:
Human chr13: MYCBP2> FBXL3> CLN5> ACOD>1 KCTD12< LMO7< UCHL3< COMMD6> TBC1D4>
XTROPCHR8: cmc4> dkc1> rbmx2< loc< loc< XB5843935>(run through) znf5354
Mouse: Slc25a14> Gpr119> Rbmx2> Gm7770> Fsip2l< Enox2< Arhgap36> Or11q2
orthogy
DIOPT/EggNog analaysis of the Xtrop protein [XP_017951589.1] matches it with > 1700 proteins in >200 species as a KDTD gene family.
Including these Mouse genes:Kctd4, Kctd14, Kctd19, Kctd12, Kctd7, Kctd16, Kctd15, Kcnrg, Kctd1, Kctd11, Kctd18, Kctd12b, Kctd6, Kctd21, Kctd8.
Further analaysi is required to best name this gene in Xenopus, so for now we will call it a Kctd12-like gene.
>XP_017951589.1 uncharacterized protein LOC100124783 isoform X1 [Xenopus tropicalis]
MALADHTSCIRQGEELPPFPDIIELNVGGQVYITRYPTLVSVPGSLLSEMFSQRNSRPLARDSKGRYFLD
RDGFLFRYVLDYMRDQQLVLPDHFPERLRLQREAEFFRLPELVKILAPKVSKQNSIGDDAFQSDSEEQSP
NVEVARNLASVSAALAAAAGNQSTMSDLRRSGFITIGYRGSYTLGRDSQTDAKFRRVARIMVCGKTSLAK
EVFGDTLNDSRDPDRPPERYTSRYYLKFTFLEQAFDRLADAGFHMVACNSTGTCAFAHDQTDDKIWTSYT
EYVFYRE