XB-FEAT-5934217: Difference between revisions

From XenWiki
Jump to navigation Jump to search
imported>Xenbase
→‎loc100498263: Updated nomenclature, replaced: unnamed → loc100498263 (2)
 
(6 intermediate revisions by the same user not shown)
Line 1: Line 1:
=loc100498263=  
=''fdx1l.2''=  
This is the community wiki page for the gene ''loc100498263'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
This is the community wiki page for the gene ''fdx1l.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
 
=orthology/homology analysis=
 
DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching
=protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485
 
>XP_002936827.1 adrenodoxin [Xenopus tropicalis]
 
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET
LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS
RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ
 
=nomenclature changes=
Based on above analysis, gene symbol updated, changing from ''fdx1b'' to ''fdx1l.2, feradoxin 1 like gene 2''

Latest revision as of 10:32, 26 April 2023

fdx1l.2

This is the community wiki page for the gene fdx1l.2 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

orthology/homology analysis

DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485

>XP_002936827.1 adrenodoxin [Xenopus tropicalis]

MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ

nomenclature changes

Based on above analysis, gene symbol updated, changing from fdx1b to fdx1l.2, feradoxin 1 like gene 2