XB-FEAT-5721986: Difference between revisions

From XenWiki
Jump to navigation Jump to search
imported>Xenbase
→‎loc100489485: Updated nomenclature, replaced: unnamed → loc100489485 (2)
 
(2 intermediate revisions by the same user not shown)
Line 1: Line 1:
=loc100489485=  
= ''cyren'' =  
This is the community wiki page for the gene ''loc100489485'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
This is the community wiki page for the gene ''cyren'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
 
=nomenclature changes=
 
25APRIL2023
''Xenopus'' gene symbol and name changed for GeneID:100489485 from ''XB5721986, modulator of retrovirus infection ''  to ''cyren, cell cycle regulator of NHEJ''
 
 
recorded synonyms are: loc100489485, XB5721986
 
=DIOPT/EggNog homology group analysis=
 
used this protein sequence
cell cycle regulator of non-homologous end joining [Xenopus tropicalis]
 
NCBI Reference Sequence: XP_002941474.3
 
>XP_002941474.3 cell cycle regulator of non-homologous end joining [Xenopus tropicalis]
MSELTLMLFIPSSICIDVYSILFRAMETVESKGKKRVLPEWMKEENVGTNISSTKNLKRKKENSSPKRLT
VYCMNERELVACALEILSEEKRRNASDMAAITEASEDQQSGESQATSPANQTSSPEVVPSTSKAPTVPET
DSDSDDDALRLIREIFFT
 
 
results: matched 71 proteins/species with high confidence: Go:MF negative regulation of double-strand break repair via nonhomologous end joining.
 
Most proteins were assigned the symbol '''C7orf49''', with  Human orthology  called '''CYREN''',  cell cycle regulator of NHEJ.
 
based on this simple analysis, this ''Xenopus'' gene has been renamed  ''cyren'', cell cycle regulator of NHEJ.

Latest revision as of 10:42, 25 April 2023

cyren

This is the community wiki page for the gene cyren please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

25APRIL2023 Xenopus gene symbol and name changed for GeneID:100489485 from XB5721986, modulator of retrovirus infection to cyren, cell cycle regulator of NHEJ


recorded synonyms are: loc100489485, XB5721986

DIOPT/EggNog homology group analysis

used this protein sequence cell cycle regulator of non-homologous end joining [Xenopus tropicalis]

NCBI Reference Sequence: XP_002941474.3

>XP_002941474.3 cell cycle regulator of non-homologous end joining [Xenopus tropicalis] MSELTLMLFIPSSICIDVYSILFRAMETVESKGKKRVLPEWMKEENVGTNISSTKNLKRKKENSSPKRLT VYCMNERELVACALEILSEEKRRNASDMAAITEASEDQQSGESQATSPANQTSSPEVVPSTSKAPTVPET DSDSDDDALRLIREIFFT


results: matched 71 proteins/species with high confidence: Go:MF negative regulation of double-strand break repair via nonhomologous end joining.

Most proteins were assigned the symbol C7orf49, with Human orthology called CYREN, cell cycle regulator of NHEJ.

based on this simple analysis, this Xenopus gene has been renamed cyren, cell cycle regulator of NHEJ.