XB-FEAT-6538722: Difference between revisions
Created page with "=''esr-5''= This is the community wiki page for the gene ''esr-5'' please feel free to add any information that is relevant to this gene that is not already captured elsewher..." |
|||
| (8 intermediate revisions by the same user not shown) | |||
| Line 1: | Line 1: | ||
=''esr-5''= | =''esr-5''= | ||
This is the community wiki page for the gene ''esr-5'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | This is the community wiki page for the gene ''esr-5'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=annotation notes= | |||
04.04.2024 | |||
The orthology of these ''Xenopus'' ''esr-5'' genes is unassigned as of 4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species). | |||
InterPro domain assessment shows the protein contains a '''bHLH-O_HES7''' and '''orange_5''' domains , which also support idea that these are Hes7 proteins and need renaming. | |||
=InterPro GO terms= | |||
'''Biological Process''' | |||
regulation of DNA-templated transcription (GO:0006355) | |||
'''Molecular Function''' | |||
DNA binding (GO:0003677) | |||
protein dimerization activity (GO:0046983) | |||
'''Cellular Component''' | |||
None | |||
=protein sequences= | |||
NB: the Xtrop and Xlaevis protein sequences are almost identical | |||
>uncharacterized protein LOC100135364 [Xenopus tropicalis] | |||
mpdmeysdtfpsrkilkpvvekqrrdrinrsleemrvlllkltgnqklqnpkmekaeilelaviyirnvthmkthdasqwvspaeklylsgfrecldrtedfiseispkaravfldnlqthlqqrlhfptqvglggpgrdheedlmssgnglspimdysisrddlslctppsslssesgspqqwlpasppnqheqapfyiwrpwp | |||
>>XP_018109262.1 PREDICTED: transcription factor HES-7 [Xenopus laevis] | |||
MPDMEYSDTFPSRKILKPVVEKQRRDRINRSLGEMRILLFQLTGNQKLQNPKMEKAEILELAVIYIRNVTRMKTHDPNKWASPAEKMYVSGFRECLDRTEDFISEISPKARAVFLDNLQTHLQQRLLLPQQVGGPGGDHEEDLMSNGSELSPIMDYSISRDELSLCTPSSSLGSESGSPPAWLPSSPPNPHEQPPLYIWRPWP | |||
Latest revision as of 08:27, 4 April 2024
esr-5
This is the community wiki page for the gene esr-5 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
annotation notes
04.04.2024 The orthology of these Xenopus esr-5 genes is unassigned as of 4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species).
InterPro domain assessment shows the protein contains a bHLH-O_HES7 and orange_5 domains , which also support idea that these are Hes7 proteins and need renaming.
InterPro GO terms
Biological Process
regulation of DNA-templated transcription (GO:0006355)
Molecular Function
DNA binding (GO:0003677)
protein dimerization activity (GO:0046983)
Cellular Component
None
protein sequences
NB: the Xtrop and Xlaevis protein sequences are almost identical
>uncharacterized protein LOC100135364 [Xenopus tropicalis] mpdmeysdtfpsrkilkpvvekqrrdrinrsleemrvlllkltgnqklqnpkmekaeilelaviyirnvthmkthdasqwvspaeklylsgfrecldrtedfiseispkaravfldnlqthlqqrlhfptqvglggpgrdheedlmssgnglspimdysisrddlslctppsslssesgspqqwlpasppnqheqapfyiwrpwp
>>XP_018109262.1 PREDICTED: transcription factor HES-7 [Xenopus laevis]
MPDMEYSDTFPSRKILKPVVEKQRRDRINRSLGEMRILLFQLTGNQKLQNPKMEKAEILELAVIYIRNVTRMKTHDPNKWASPAEKMYVSGFRECLDRTEDFISEISPKARAVFLDNLQTHLQQRLLLPQQVGGPGGDHEEDLMSNGSELSPIMDYSISRDELSLCTPSSSLGSESGSPPAWLPSSPPNPHEQPPLYIWRPWP