XB-FEAT-22166507: Difference between revisions

From XenWiki
Jump to navigation Jump to search
 
(One intermediate revision by the same user not shown)
Line 22: Line 22:
Gene name changed from  'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2 like'
Gene name changed from  'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2 like'


=homology of Xtrop protein=
=homology of ''X. tropicalis'' protein=
uncharacterized protein ig100492381 [Xenopus tropicalis]
uncharacterized protein ig100492381 [Xenopus tropicalis]


Line 28: Line 28:


>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis]
>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis]
MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVR
MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVRCTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDKSSASATINVTVEDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLGMETKPPRRNMIRKYYGPTWIQ
CTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDSKSSASATINVTV
EDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLG
METKPPRRNMIRKYYGPTWIQ


DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including Xtropicalis accession 8364.ENSXETP00000030379
DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including X. tropicalis accession 8364.ENSXETP00000030379


=synteny and orthology=
=synteny and orthology=

Latest revision as of 08:13, 25 April 2023

hepacam2l

This is the community wiki page for the gene hepacam2l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

11.30.2020.

This gene 's name was corrected by removing human loci number from the gene name and gene symbol, following notification of the issue by NCBIs refseq coordinator (RSCOM-106).

Name changed from: uncharacterized protein containing Ig superfamily v domain 100492381 [provisional] to uncharacterized protein containing Ig superfamily v domain [provisional]

Symbol changed from ig100492381 to XB22166507 [provisonal]


25April2023

based on DIOPT/homology group analysis of protein by Xenbase curation team:

Symbol changed from XB22166507 [provisional] to hepacam2l

Gene name changed from 'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2 like'

homology of X. tropicalis protein

uncharacterized protein ig100492381 [Xenopus tropicalis]

NCBI Reference Sequence: XP_002936341.1

>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis] MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVRCTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDKSSASATINVTVEDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLGMETKPPRRNMIRKYYGPTWIQ

DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including X. tropicalis accession 8364.ENSXETP00000030379

synteny and orthology

The Xenopus hepacam2 gene which is considered the true ortholog of Human HEPACAM2, based on conserved synteny and protein architecture, is found on Chr6/6l/6S in Xenopus

Synteny pattern:

Xenopus chr6/6L/6S: samd9l .. hepacam2 ... vps50... Loc# ..LOC# ... calcr

human: SAMD9L ... HEPACAM2 ...VPS50 ....//

This second 'hepacam2' like gene is found in Xenopus on chromosomes 1/1L/1S, and it is therefore NOT the true ortholog of the human HEPACAM2.

Xenopus Chr1/1L/1S: adissp> ... hspa12b< ... lyrm2< ... hepacam2l< ... gpr151 ... rnf145l