XB-FEAT-22166507: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 13: Line 13:


25April2023
25April2023
based on DIOPT/homology group analysis of protein by Xenbase curation team:


Symbol changed from ''XB22166507 [provisonal]'' to ''hepacam2' provisional


Symbol changed from ''XB22166507 [provisonal]'' to ''hepacam2' provisional based on DIOPT/homology group analysis of protein.
Gene name changed from 'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2'


=homology of Xtrop protein=
=homology of Xtrop protein=

Revision as of 08:44, 25 April 2023

XB22166507 [provisonal]

This is the community wiki page for the gene XB22166507 [provisional] please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

11.30.2020. This gene 's name was corrected by removing human loci number from the gene name and gene symbol, following notification of the issue by NCBIs refseq coordinator (RSCOM-106).

Name changed from: uncharacterized protein containing Ig superfamily v domain 100492381 [provisional] to uncharacterized protein containing Ig superfamily v domain [provisional]

Symbol changed from ig100492381 to XB22166507 [provisonal]

25April2023 based on DIOPT/homology group analysis of protein by Xenbase curation team:

Symbol changed from XB22166507 [provisonal] to hepacam2' provisional

Gene name changed from 'uncharacterized protein containing Ig superfamily v domain [provisional]' to 'HEPACAM family member 2'

homology of Xtrop protein

uncharacterized protein ig100492381 [Xenopus tropicalis]

NCBI Reference Sequence: XP_002936341.1

>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis] MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVR CTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDSKSSASATINVTV EDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLG METKPPRRNMIRKYYGPTWIQ

DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including Xtropicalis accession 8364.ENSXETP00000030379