XB-FEAT-5934217: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 11: Line 11:
=nomenclature changes=
=nomenclature changes=
Based on above analysis, gene symbol updated, changing from ''fdx1b'' to ''fdx1''
Based on above analysis, gene symbol updated, changing from ''fdx1b'' to ''fdx1''
>XP_002936827.1 adrenodoxin [Xenopus tropicalis]
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET
LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS
RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ

Revision as of 10:28, 26 April 2023

fdx1

This is the community wiki page for the gene fdx1 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

orthology/homology analysis

DIOPT/EggNog identifies this protein as a Ferredoxin with very high certainty, matching =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L

- ENSXETP00000046485


nomenclature changes

Based on above analysis, gene symbol updated, changing from fdx1b to fdx1