XB-FEAT-5934217: Difference between revisions
Jump to navigation
Jump to search
Line 4: | Line 4: | ||
=orthology/homology analysis= | =orthology/homology analysis= | ||
DIOPT/EggNog identifies this protein as a Ferredoxin with very high certainty, matching | DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching | ||
=protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L | =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485 | ||
>XP_002936827.1 adrenodoxin [Xenopus tropicalis] | |||
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET | |||
LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS | |||
RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ | |||
=nomenclature changes= | =nomenclature changes= | ||
Based on above analysis, gene symbol updated, changing from ''fdx1b'' to ''fdx1'' | Based on above analysis, gene symbol updated, changing from ''fdx1b'' to ''fdx1'' |
Revision as of 10:28, 26 April 2023
fdx1
This is the community wiki page for the gene fdx1 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
orthology/homology analysis
DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485
>XP_002936827.1 adrenodoxin [Xenopus tropicalis]
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ
nomenclature changes
Based on above analysis, gene symbol updated, changing from fdx1b to fdx1