XB-FEAT-982798: Difference between revisions
| Line 13: | Line 13: | ||
ANGSFRLNKKKLEGLPFEKKAAPPAKPPSKRRAPAASSSPAKSHKKAKPTAEKEKPQKSSVKAPSKSHKK | ANGSFRLNKKKLEGLPFEKKAAPPAKPPSKRRAPAASSSPAKSHKKAKPTAEKEKPQKSSVKAPSKSHKK | ||
GAKGKKVKKGAKPSVPKVPKSKKA | GAKGKKVKKGAKPSVPKVPKSKKA | ||
=orthology= | |||
DIOPT/EggNog matches this protein ( omitting teh long string of EEEEEs) matching >600 proteins from >200 species including reptiles and mammals. matches to Mouse | |||
and rat, below, show that this is likely a histone but the gene symbol to use here is unclear: | |||
Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c | |||
Rattus norvegicus 9 seqs 10116.ENSRNOP00000019696, 10116.ENSRNOP00000065338, 10116.ENSRNOP00000023054, 10116.ENSRNOP00000006172, 10116.ENSRNOP00000048205, 10116.ENSRNOP00000032882, 10116.ENSRNOP00000066786, 10116.ENSRNOP00000024304, 10116.ENSRNOP00000053053 Hp1bp3, LOC684828, Hist1h1a, Rbm43, H1foo, H1fx, Hist1h1d, Hist1h1b, H1f0 | |||
Gene name wise, we might goin with 'rbm43-like' for now for simplicity. | |||
Revision as of 13:36, 26 April 2023
mgc69473
This is the community wiki page for the gene mgc69473 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
protein
uncharacterized protein LOC407914 [Xenopus tropicalis]
NCBI Reference Sequence: NP_001001233.1
>NP_001001233.1 uncharacterized protein LOC407914 [Xenopus tropicalis]
MALELEENLHSEEEEEEDEEEEEEEEEEEEEEEEEEEEEGGGMQTRSPSKRNKGGASSSSSSSGSAKKKK
KKKNQPGRYSQLVVDTIRKLGERNGSSLAKIYSEAKKVAWFDQQNGRTYLKYSIKALVQNDTLLQVKGVG
ANGSFRLNKKKLEGLPFEKKAAPPAKPPSKRRAPAASSSPAKSHKKAKPTAEKEKPQKSSVKAPSKSHKK
GAKGKKVKKGAKPSVPKVPKSKKA
orthology
DIOPT/EggNog matches this protein ( omitting teh long string of EEEEEs) matching >600 proteins from >200 species including reptiles and mammals. matches to Mouse and rat, below, show that this is likely a histone but the gene symbol to use here is unclear:
Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c
Rattus norvegicus 9 seqs 10116.ENSRNOP00000019696, 10116.ENSRNOP00000065338, 10116.ENSRNOP00000023054, 10116.ENSRNOP00000006172, 10116.ENSRNOP00000048205, 10116.ENSRNOP00000032882, 10116.ENSRNOP00000066786, 10116.ENSRNOP00000024304, 10116.ENSRNOP00000053053 Hp1bp3, LOC684828, Hist1h1a, Rbm43, H1foo, H1fx, Hist1h1d, Hist1h1b, H1f0
Gene name wise, we might goin with 'rbm43-like' for now for simplicity.