XB-FEAT-29084766: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 34: Line 34:
=synteny=
=synteny=
11DEC2023
11DEC2023
Strangely, NCBI has the ''X.trop mpzl3'' gene listed as an orthology of human JAML, even though the structure/architecture of this protein is completely different, but it is very close to in in the systemic pattern- see table below (using mpzl2 as anchor).
Strangely, NCBI has the ''X.trop mpzl3'' gene listed as an orthology of human JAML, even though the structure/architecture of this protein is completely different, but it is very close to in in the syntenic pattern- see table below (using mpzl2 as anchor).


<div style="overflow-x: scroll">
<div style="overflow-x: scroll">

Revision as of 09:25, 11 December 2023

protein

uncharacterized protein LOC101730711 [Xenopus tropicalis]

NCBI Reference Sequence: XP_017952313.2

>XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS ESEESSSES

homology group analysis via EggNOGG v5

11DEC2023 LOC101730711 is an uncharacterized protein coding gene on Xtr.chr8, among cluster of uncharacterized gens, carrying LOC##### symbols.

Species Chromosome < 5 < 4 < 3 < 2 < 1 Gene of Interest > 1 > 2 > 3 > 4 > 5
X.tropicalis chr8 cfap45 nlrp4 LOC116406898 LOC116406897 LOC100486737 GeneID:101730711;LOC101730711; LOC100488807 LOC100488643 LOC101730590 LOC116406952 LOC100491706


The protein sequence o fthis uncharacterized protein matches 434 proteins in 96 species with high confidence, most of which are named amica1

the protein has 1 or more Immunoglobulin V-set domain(s) and has assigned monocyte extravasation as a major molecular function.

synteny

11DEC2023 Strangely, NCBI has the X.trop mpzl3 gene listed as an orthology of human JAML, even though the structure/architecture of this protein is completely different, but it is very close to in in the syntenic pattern- see table below (using mpzl2 as anchor).

Species Chromosome < 5 < 4 < 3 < 2 < 1 Gene of Interest > 1 > 2 > 3 > 4 > 5
X.tropicalis chr7 atp5mg ube4a LOC116412324 cd3g cd3e GeneID:549209;mpzl2; mpzl3 scn2b scn4b tmprss4 smim35
X.laevis chr7L vps11.L kmt2a.L atp5mg.L ube4a.L cd3e.L GeneID:446705;mpzl2.L; mpzl3.L scn2b.L LOC121395544 scn4b.L tmprss4.L
H.sapiens Chr11 scn4b scn2b JAML HSPE1P18 mpzl3 GeneID:10205; MPZL2 cd3e CD3D cd3g ube4a LOC100131626
M.musculus chr9 ube4a Gm19121 cd3g CD3D cd3e GeneID:14012; Mpzl2 mpzl3 JAML Gm10684 scn2b scn4b

nomenclature changes

AMICA1, is now called JAML junction adhesion molecule like in Homo sapiens (human) (Gene ID: 120425) which was updated on NCBI on 23-Nov-2023

Based on these preliminary analysis, the Xtrop gene is here jaml, junction adhesion molecule like