XB-FEAT-6538722: Difference between revisions
| Line 7: | Line 7: | ||
The orthology of these ''Xenopus'' ''esr-5'' genes is unassigned as of 4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species). | The orthology of these ''Xenopus'' ''esr-5'' genes is unassigned as of 4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species). | ||
protein domains therefore | protein domains | ||
=protein sequnces= | |||
>uncharacterized protein LOC100135364 [Xenopus tropicalis] | |||
mpdmeysdtfpsrkilkpvvekqrrdrinrsleemrvlllkltgnqklqnpkmekaeilelaviyirnvthmkthdasqwvspaeklylsgfrecldrtedfiseispkaravfldnlqthlqqrlhfptqvglggpgrdheedlmssgnglspimdysisrddlslctppsslssesgspqqwlpasppnqheqapfyiwrpwp | |||
therefore | |||
hairy and enhancer of split 2/6/7,hairy and enhancer of split related with YRPW motif,hairy and enhancer of split 5 | hairy and enhancer of split 2/6/7,hairy and enhancer of split related with YRPW motif,hairy and enhancer of split 5 | ||
Revision as of 07:51, 4 April 2024
esr-5
This is the community wiki page for the gene esr-5 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
annotation notes
04.04.2024
The orthology of these Xenopus esr-5 genes is unassigned as of 4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species).
protein domains
protein sequnces
>uncharacterized protein LOC100135364 [Xenopus tropicalis] mpdmeysdtfpsrkilkpvvekqrrdrinrsleemrvlllkltgnqklqnpkmekaeilelaviyirnvthmkthdasqwvspaeklylsgfrecldrtedfiseispkaravfldnlqthlqqrlhfptqvglggpgrdheedlmssgnglspimdysisrddlslctppsslssesgspqqwlpasppnqheqapfyiwrpwp
therefore
hairy and enhancer of split 2/6/7,hairy and enhancer of split related with YRPW motif,hairy and enhancer of split 5