XB-FEAT-22063310: Difference between revisions
Line 8: | Line 8: | ||
''Xenopus'' gene symbol changed from ''spaca5'' to ''spaca5.2''. Synteny support the other ''spaca5'' gene on chr 8 as the true ortholog of the human SPACA5 gene. | ''Xenopus'' gene symbol changed from ''spaca5'' to ''spaca5.2''. Synteny support the other ''spaca5'' gene on chr 8 as the true ortholog of the human SPACA5 gene. | ||
10MARCH2025 | |||
There were 4 genes annotated as 'spaca5' and 'spaca5l' in the v10 ''Xenopus'' genome assemblies. | |||
Synteny supports the 2 gene models on Chr8/8L/8S, as the true orthologs of the human SPACA5 gene. | |||
The names of the ''spaca5'' genes on chr10/9_10L have been changed to 'spaca5-like' genes 1 and 2. | |||
=orthology= | =orthology= |
Revision as of 10:22, 10 March 2025
nomenclature changes
26April2023
Xenopus gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to spaca5, sperm acrosome associated 5
08MARCH20205
Xenopus gene symbol changed from spaca5 to spaca5.2. Synteny support the other spaca5 gene on chr 8 as the true ortholog of the human SPACA5 gene.
10MARCH2025
There were 4 genes annotated as 'spaca5' and 'spaca5l' in the v10 Xenopus genome assemblies.
Synteny supports the 2 gene models on Chr8/8L/8S, as the true orthologs of the human SPACA5 gene.
The names of the spaca5 genes on chr10/9_10L have been changed to 'spaca5-like' genes 1 and 2.
orthology
26April2023
DIOPT/EggNog analysis of the Xenopus protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.
Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)
protein used in DIOPT analysis
dentin sialophosphoprotein-like [Xenopus tropicalis]
NCBI Reference Sequence: XP_031746799.1
>XP_031746799.1 dentin sialophosphoprotein-like [Xenopus tropicalis] MKLILGLLVLFPWTLRAQDNQMVTSNDSDITTGVNSEQQTDASNSTSDQGSYNNTYNTLTTGSDSYTTET AAADAPTDSSDPLPTNSSSYNTDGNMLENKDALLVTSVNNNVLESTVMSSSPTSTDSGTYSTAESTVYSL SKSEGDSASEDQSNENSNSMESEQGDTSCAVYEILREAGMVGYRGLSAADWICVLKMTNLFHPSEKNAVR CRNLKSHKAKYSCECFGDNVHKYIQCQMKTMRDPTDLWNQFCNGKDLSQYTRACESQLPQEPRKY
this makes no sense to me - CJZ