XB-FEAT-22063310: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 22: Line 22:
DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.
DIOPT/EggNog analysis of the ''Xenopus'' protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.


Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)  
Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)
 
=protein used in DIOPT analysis=
dentin sialophosphoprotein-like [Xenopus tropicalis]
 
NCBI Reference Sequence: XP_031746799.1
 
>XP_031746799.1 dentin sialophosphoprotein-like [Xenopus tropicalis]
MKLILGLLVLFPWTLRAQDNQMVTSNDSDITTGVNSEQQTDASNSTSDQGSYNNTYNTLTTGSDSYTTET
AAADAPTDSSDPLPTNSSSYNTDGNMLENKDALLVTSVNNNVLESTVMSSSPTSTDSGTYSTAESTVYSL
SKSEGDSASEDQSNENSNSMESEQGDTSCAVYEILREAGMVGYRGLSAADWICVLKMTNLFHPSEKNAVR
CRNLKSHKAKYSCECFGDNVHKYIQCQMKTMRDPTDLWNQFCNGKDLSQYTRACESQLPQEPRKY
 
 
this makes no sense to me - CJZ

Revision as of 10:22, 10 March 2025

nomenclature changes

26April2023

Xenopus gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to spaca5, sperm acrosome associated 5

08MARCH20205

Xenopus gene symbol changed from spaca5 to spaca5.2. Synteny support the other spaca5 gene on chr 8 as the true ortholog of the human SPACA5 gene.

10MARCH2025

There were 4 genes annotated as 'spaca5' and 'spaca5l' in the v10 Xenopus genome assemblies.

Synteny supports the 2 gene models on Chr8/8L/8S, as the true orthologs of the human SPACA5 gene.

The names of the spaca5 genes on chr10/9_10L have been changed to 'spaca5-like' genes 1 and 2.

orthology

26April2023

DIOPT/EggNog analysis of the Xenopus protein for this gene confirms it as a member of the SPACA5 homology group, and the gene name was updated as indicated.

Note that the NCBI/UniProt name for protein needs reassessing ( not dentin sialophosphoprotein-like)