XB-FEAT-22166267: Difference between revisions
| Line 3: | Line 3: | ||
This is the community wiki page for the gene ''wdr88l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | This is the community wiki page for the gene ''wdr88l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
= | =nomenclature changes= | ||
04JAN2023 | 04JAN2023 | ||
gene name changed from ''loc100145065'' to ''WD repeat domain 88 like'' | gene name changed from ''loc100145065'' to ''WD repeat domain 88 like'' | ||
| Line 9: | Line 9: | ||
gene symbol changed from ''XB22166267'' to ''wdr88l'' | gene symbol changed from ''XB22166267'' to ''wdr88l'' | ||
both gene name and symbols are given provisional staus tags, as teh identity is uncertain. | both gene name and symbols are given provisional staus tags, as teh identity is uncertain. | ||
=Protein sequence= | =Protein sequence= | ||
Revision as of 12:54, 4 January 2023
wdr88l
This is the community wiki page for the gene wdr88l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
04JAN2023 gene name changed from loc100145065 to WD repeat domain 88 like
gene symbol changed from XB22166267 to wdr88l
both gene name and symbols are given provisional staus tags, as teh identity is uncertain.
Protein sequence
LSSKVAARKFPSVPSQETPSRMDQELTDGSVGRAWTPQETQAMLDLIRDLGLGPALTRKGYQNWDVFERLQVLLSHCRVRASSAEIKAQW QALKMKFWRLKRFVGLAPLVAITADFPFYQQMEQLLEPQKRMEICSREADSTIQESGRPTSSLSDSPSDEDMTDDASIPEVHHEQEPAIN NGGNLHPENVQEAAPQDGAAIRNPHLAPEALADLEPEPIRLLQTTMGQLVEGMAQLVQTLNRVCGVQEQISIQLGYFCSLLPKFPIQMGS GRPRNQEGGKCPEKKPVVHGPRNSRGLRRSLRIKKFAARYSS
This partial sequence contains a Myb/SANT-like DNA-binding domain, and when entered into the DIOPT EggNogg tool, is close homolog to Xenopus wdr88 gene, and 2 other sequemces ( weak evidence at best). Thus the gene is provisonally named wdr88 like