XB-FEAT-22166507: Difference between revisions
imported>Xenbase Created page with "=''XB22166507 [provisonal]''= This is the community wiki page for the gene ''XB22166507 [provisional]'' please feel free to add any information that is relevant to this gene..." |
|||
Line 11: | Line 11: | ||
Symbol changed from ''ig100492381'' to ''XB22166507 [provisonal]'' | Symbol changed from ''ig100492381'' to ''XB22166507 [provisonal]'' | ||
25April2023 | |||
Symbol changed from ''XB22166507 [provisonal]'' to ''hepacam2' provisional based on DIOPT/homology group analysis of protein. | |||
=homology of Xtrop protein= | |||
uncharacterized protein ig100492381 [Xenopus tropicalis] | |||
NCBI Reference Sequence: XP_002936341.1 | |||
>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis] | |||
MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVR | |||
CTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDSKSSASATINVTV | |||
EDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLG | |||
METKPPRRNMIRKYYGPTWIQ | |||
DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including Xtropicalis accession 8364.ENSXETP00000030379 |
Revision as of 07:40, 25 April 2023
XB22166507 [provisonal]
This is the community wiki page for the gene XB22166507 [provisional] please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
11.30.2020. This gene 's name was corrected by removing human loci number from the gene name and gene symbol, following notification of the issue by NCBIs refseq coordinator (RSCOM-106).
Name changed from: uncharacterized protein containing Ig superfamily v domain 100492381 [provisional] to uncharacterized protein containing Ig superfamily v domain [provisional]
Symbol changed from ig100492381 to XB22166507 [provisonal]
25April2023
Symbol changed from XB22166507 [provisonal] to hepacam2' provisional based on DIOPT/homology group analysis of protein.
homology of Xtrop protein
uncharacterized protein ig100492381 [Xenopus tropicalis]
NCBI Reference Sequence: XP_002936341.1
>XP_002936341.1 uncharacterized protein ig100492381 [Xenopus tropicalis] MLGTASALLLLPLFILSGSYEAFNISASRSHVRGTQNSSLLLSISYNILPETSWIQIKWDLLDPKTELVR CTIRGPNSSSEEENLSIKTFPPGGFEGRMHIIPENGSLVIHRLAQSDSGIYQVTLRDSKSSASATINVTV EDAKKAITSVWEHVPATPNNTETEMKTQTAPYCFCTSNSSSVSLPTSAGIVLGSRIFTMLITLTIFFCLG METKPPRRNMIRKYYGPTWIQ
DIOPT/EggNogg analysis of this protein identifies it as an ortholog of HEPACAM2 with high confidence, aligning it to the homology group with over 100 other species, including Xtropicalis accession 8364.ENSXETP00000030379