XB-FEAT-22167168: Difference between revisions
Line 6: | Line 6: | ||
04JAN2023 | 04JAN2023 | ||
gene name was changed from ''XB22167168'' to ''ring finger and CHY zinc finger domain containing 1 | gene name was changed from ''XB22167168'' to ''ring finger and CHY zinc finger domain containing 1 like'' | ||
gene synbol was changed from ''uncharacterized XB22167168'' to '' | gene synbol was changed from ''uncharacterized XB22167168'' to ''rchy1l'' | ||
Using the DIOPT Eggnog tool the protein from this gene found on ''Xenopus'' Chr3/3L (v10 genome assemblies) matches '''Rchy1''' ''ring finger and CHY zinc finger domain containing 1'' in 447 species with high confidence. True RCHY1 orthologs are however the genes on Chr1/1L. This gene will therefore be provisionally named '' | Using the DIOPT Eggnog tool the protein from this gene found on ''Xenopus'' Chr3/3L (v10 genome assemblies) matches '''Rchy1''' ''ring finger and CHY zinc finger domain containing 1'' in 447 species with high confidence. True RCHY1 orthologs are however the genes on Chr1/1L. This gene will therefore be provisionally named ''rchy1l'' | ||
==protein sequence for ''X. tropicalis rchy1l'' used in orthology group analysis= | ==protein sequence for ''X. tropicalis rchy1l'' used in orthology group analysis= |
Revision as of 11:28, 25 April 2023
rchy1.2
This is the community wiki page for the Xenopus gene rchy1.2. Feel free to note here anything about rchy1.2 that is not recorded elsewhere on Xenbase.
nomenclature changes
04JAN2023
gene name was changed from XB22167168 to ring finger and CHY zinc finger domain containing 1 like
gene synbol was changed from uncharacterized XB22167168 to rchy1l
Using the DIOPT Eggnog tool the protein from this gene found on Xenopus Chr3/3L (v10 genome assemblies) matches Rchy1 ring finger and CHY zinc finger domain containing 1 in 447 species with high confidence. True RCHY1 orthologs are however the genes on Chr1/1L. This gene will therefore be provisionally named rchy1l
=protein sequence for X. tropicalis rchy1l used in orthology group analysis
MAEGQVQSVKVPPVNEDGVTCSQEKFHRQQPQHLCKFFSQGRYCRFGNRCRFLHQLAECQNSEKNRKQNVSCKLTEKSNATAISCSPNNS FSDPVKKGLGSHQRKYQPRKLCRYFASGFCAMENHCKFWHPDNHPPINDGHPQDKKAAATSTVVRMPVERPQALPESLRFGDVTLDMAKK LRETEISQLLKRFPKDKVIVQEREDGEVTYYRVTVEPTDPDWPFDLKEMEIMLEFPDDYPLKVFTVQIPEDQDLPPVMCRHVREASLTWL EAKHATNQLIGKVELLFRPYLHWLDRNMERLFTEGARLLKRDVDAEKAGIEFVPYQQLQALVIESSCDKSARETVTQNNPEDPPDESLEE DSDDWTSCDDDDDDDELEPGPDDRMKSIEGGGTEAPKKGTEIRFLGLKLGEDVGTLMAHCISVSLQCNRCQTIADLSVSGRQPCTAQCDR CNSRISGAFHPRVIHQFSAVLGYVDIQGASPKDLILQDCDFIFSCLSCSQEGQVQSLSYGIPKDLNCLHCHCKLSISVEATKFQKVERCP AKIIGSKGLLNQGRKRAVKDPSIQPGKPLPDHGTCRHYRKSCRWLRFPCCGKAYPCDVCHDDAEDHEMELASRMICGYCAKEQAYTNGKP CTSCGNMMSKGLHSGHWEGGRGCRNKVKMSRKDKQKYANSSKTVSRRSVSKF