XB-FEAT-17329844: Difference between revisions
Jump to navigation
Jump to search
(→symbol) |
|||
Line 1: | Line 1: | ||
='' | =''prss57''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''prss57'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=nomenclature changes= | =nomenclature changes= |
Revision as of 10:58, 26 April 2023
prss57
This is the community wiki page for the gene prss57 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
26APRIL2023
Xenopus gene symbol and name changed from XB17329844 [provisional] to prss57, serine protease 57
protein for GeneID:100497492
>XP_002937430.1 serine protease 57 [Xenopus tropicalis]
MMMHLVLLTAALFSLPSSETYRIVGGHEAKPHSRPYMVSLQRQDKSHFCGGTLIHPKWVLTAAHCQEGWS MDLTRVVLGAHWLYWSDRPVQVFRTLKFVQHPQFNPQTFQSDLLLLKLNDSVHFSPAVRTIPLPAPNTDV IPGTACSVAGWGLTSDSGTRPFALMEADVDVISRMSCNKTWLGGIDESMLCTATPGAPFKGFCDGDSGGP LVCGDRVEGVVSFSGSYCGDPHTPDVYTRVTSFLDWIQETISEF