XB-FEAT-17329844: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 7: Line 7:


''Xenopus'' gene symbol and name changed from XB17329844 [provisional] to ''prss57, serine protease 57''
''Xenopus'' gene symbol and name changed from XB17329844 [provisional] to ''prss57, serine protease 57''
=orthology=
DIOPT/EggNogg analysis of the protein below [XP_002937430.1] confirms that this Xenopus protein is a serine protease matching it to the homology group with 18,000 other PRSS protein from ~300 species.


=protein for GeneID:100497492=
=protein for GeneID:100497492=

Revision as of 10:01, 26 April 2023

prss57

This is the community wiki page for the gene prss57 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

26APRIL2023

Xenopus gene symbol and name changed from XB17329844 [provisional] to prss57, serine protease 57

orthology

DIOPT/EggNogg analysis of the protein below [XP_002937430.1] confirms that this Xenopus protein is a serine protease matching it to the homology group with 18,000 other PRSS protein from ~300 species.


protein for GeneID:100497492

>XP_002937430.1 serine protease 57 [Xenopus tropicalis]

MMMHLVLLTAALFSLPSSETYRIVGGHEAKPHSRPYMVSLQRQDKSHFCGGTLIHPKWVLTAAHCQEGWS MDLTRVVLGAHWLYWSDRPVQVFRTLKFVQHPQFNPQTFQSDLLLLKLNDSVHFSPAVRTIPLPAPNTDV IPGTACSVAGWGLTSDSGTRPFALMEADVDVISRMSCNKTWLGGIDESMLCTATPGAPFKGFCDGDSGGP LVCGDRVEGVVSFSGSYCGDPHTPDVYTRVTSFLDWIQETISEF