XB-FEAT-5934217: Difference between revisions
Jump to navigation
Jump to search
Line 1: | Line 1: | ||
='' | =''fdx1''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''fdx1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=orthology/homology analysis= | |||
DIOPT/EggNog identifies this protein as a Ferredoxin with very high certainty, matching | |||
=protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L | |||
- ENSXETP00000046485 | |||
=nomenclature changes= | |||
Based on above analysis, gene symbol updated, changing from ''fdx1b'' to ''fdx1'' | |||
>XP_002936827.1 adrenodoxin [Xenopus tropicalis] | |||
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET | |||
LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS | |||
RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ |
Revision as of 10:27, 26 April 2023
fdx1
This is the community wiki page for the gene fdx1 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
orthology/homology analysis
DIOPT/EggNog identifies this protein as a Ferredoxin with very high certainty, matching =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L
- ENSXETP00000046485
nomenclature changes
Based on above analysis, gene symbol updated, changing from fdx1b to fdx1
>XP_002936827.1 adrenodoxin [Xenopus tropicalis]
MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ