XB-FEAT-940377: Difference between revisions
imported>Xenbase gene generator No edit summary |
|||
| Line 1: | Line 1: | ||
=unnamed= | =unnamed= | ||
This is the community wiki page for the gene ''unnamed'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | This is the community wiki page for the gene ''unnamed'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase | ||
=orthology and homology groups= | |||
22MAY2023 | |||
Using DIOPT/EGGNOG tool to assess the likely identity of this gene, it matches >2400 proteins from >400 species. | |||
The NCBI refSeq Protein accession for this''X. tropicalis'' gene matches 17 sequences for ''X.tropicalis'' in ENSMBL dtabse: | |||
17 seqs 8364.ENSXETP00000057169, 8364.ENSXETP00000015664, 8364.ENSXETP00000048888, 8364.ENSXETP00000021658, 8364.ENSXETP00000062384, 8364.ENSXETP00000023728, 8364.ENSXETP00000064034, 8364.ENSXETP00000063506, 8364.ENSXETP00000014000, 8364.ENSXETP00000023716, 8364.ENSXETP00000035701, 8364.ENSXETP00000009033, 8364.ENSXETP00000001012, 8364.ENSXETP00000034708, 8364.ENSXETP00000061262, 8364.ENSXETP00000017352, 8364.ENSXETP00000058282 ccni, 8364.ENSXETP00000015664, ccnb3, 8364.ENSXETP00000021658, 8364.ENSXETP00000062384, ccnb2, 8364.ENSXETP00000064034, 8364.ENSXETP00000063506, ccng2, LOC394448, ccnb1.2, ccni2, ccnb1, cntd2, 8364.ENSXETP00000061262, ccng1, ccno | |||
It also matches these Chicken/Gallus proteins: 7 seqs 9031.ENSGALP00000018658, 9031.ENSGALP00000039111, 9031.ENSGALP00000002633, 9031.ENSGALP00000016827, 9031.ENSGALP00000041819, 9031.ENSGALP00000041991, 9031.ENSGALP00000006605 CCNI, CCNI2, CCNG1, CCNG2, CCNB3, CCNO, CCNB2. | |||
and these proteinsin Mouse and rat. | |||
Mus musculus 4 seqs 10090.ENSMUSP00000029270, 10090.ENSMUSP00000058111, 10090.ENSMUSP00000111048, 10090.ENSMUSP00000029368 Ccna2, Ccnjl, Ccnf, Ccna1 | |||
Rattus norvegicus 5 seqs 10116.ENSRNOP00000021156, 10116.ENSRNOP00000060445, 10116.ENSRNOP00000039931, 10116.ENSRNOP00000005171, 10116.ENSRNOP00000039779 Ccna2, Ccnf, Ccna1, Ccnjl, Apob | |||
note that: | |||
Ccna2, is cylin A2 | |||
Ccnf, is cyclin F | |||
Ccna1,is cylin A1 | |||
Ccng1, i s cyclin G1 | |||
Ccno is cyclin O | |||
SO we can confidently say this is another cyclin gene. The cyclins consist of 8 classes of cell cycle regulators, designated A-G, also Q & S in invertebates, that regulate cyclin dependent kinases (CDKs), so further phylogenetic assessment is required to classify this protein. | |||
=protein accession= | |||
uncharacterized protein LOC100127658 [Xenopus tropicalis] | |||
NCBI Reference Sequence: NP_001106473.2 | |||
>NP_001106473.2 uncharacterized protein LOC100127658 [Xenopus tropicalis] | |||
MEILSVGMRKRRREEEEEQEEEIISPGCSPEFKRAKPQGDLRGTSTPTAEEPVPEGEPWNTLTNLADALQ | |||
TFREYGEECYLYKKGLEGGYQLENFLENQKDINPTSWNHITTLMINVHRYLRLDFQTLCLGINFLERYVS | |||
CTPTNPDTLTRVGATCLYMAYKVAELRYPLPPKLFLPLFDYRMTPAEMRHLERTILRKLLFRLGVPTIDF | |||
FLEHFSLLRLTNQEECSPAQLKRAAKSLTAARGIAALCLNQHQDFYMHKPSLMALCCLNVADKIYSYNNP | |||
VKVAPTDYPEHQIEECMEKICHLVSIGHYFLHPLLPGVYPAIFPAFNPPTTRPAATPTNQHLPEGRERTP | |||
EVASTSRDTAGSQHLEMAERSSHSQDMEGAGYVLHNTYWPTDPYRQVYMHPYMPTPPYWHPYMPPVSYWH | |||
PYMHTLPYLHPYGYIFPY | |||
Revision as of 11:38, 22 May 2023
unnamed
This is the community wiki page for the gene unnamed please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase
orthology and homology groups
22MAY2023
Using DIOPT/EGGNOG tool to assess the likely identity of this gene, it matches >2400 proteins from >400 species.
The NCBI refSeq Protein accession for thisX. tropicalis gene matches 17 sequences for X.tropicalis in ENSMBL dtabse:
17 seqs 8364.ENSXETP00000057169, 8364.ENSXETP00000015664, 8364.ENSXETP00000048888, 8364.ENSXETP00000021658, 8364.ENSXETP00000062384, 8364.ENSXETP00000023728, 8364.ENSXETP00000064034, 8364.ENSXETP00000063506, 8364.ENSXETP00000014000, 8364.ENSXETP00000023716, 8364.ENSXETP00000035701, 8364.ENSXETP00000009033, 8364.ENSXETP00000001012, 8364.ENSXETP00000034708, 8364.ENSXETP00000061262, 8364.ENSXETP00000017352, 8364.ENSXETP00000058282 ccni, 8364.ENSXETP00000015664, ccnb3, 8364.ENSXETP00000021658, 8364.ENSXETP00000062384, ccnb2, 8364.ENSXETP00000064034, 8364.ENSXETP00000063506, ccng2, LOC394448, ccnb1.2, ccni2, ccnb1, cntd2, 8364.ENSXETP00000061262, ccng1, ccno
It also matches these Chicken/Gallus proteins: 7 seqs 9031.ENSGALP00000018658, 9031.ENSGALP00000039111, 9031.ENSGALP00000002633, 9031.ENSGALP00000016827, 9031.ENSGALP00000041819, 9031.ENSGALP00000041991, 9031.ENSGALP00000006605 CCNI, CCNI2, CCNG1, CCNG2, CCNB3, CCNO, CCNB2.
and these proteinsin Mouse and rat.
Mus musculus 4 seqs 10090.ENSMUSP00000029270, 10090.ENSMUSP00000058111, 10090.ENSMUSP00000111048, 10090.ENSMUSP00000029368 Ccna2, Ccnjl, Ccnf, Ccna1
Rattus norvegicus 5 seqs 10116.ENSRNOP00000021156, 10116.ENSRNOP00000060445, 10116.ENSRNOP00000039931, 10116.ENSRNOP00000005171, 10116.ENSRNOP00000039779 Ccna2, Ccnf, Ccna1, Ccnjl, Apob
note that:
Ccna2, is cylin A2
Ccnf, is cyclin F
Ccna1,is cylin A1
Ccng1, i s cyclin G1
Ccno is cyclin O
SO we can confidently say this is another cyclin gene. The cyclins consist of 8 classes of cell cycle regulators, designated A-G, also Q & S in invertebates, that regulate cyclin dependent kinases (CDKs), so further phylogenetic assessment is required to classify this protein.
protein accession
uncharacterized protein LOC100127658 [Xenopus tropicalis]
NCBI Reference Sequence: NP_001106473.2
>NP_001106473.2 uncharacterized protein LOC100127658 [Xenopus tropicalis]
MEILSVGMRKRRREEEEEQEEEIISPGCSPEFKRAKPQGDLRGTSTPTAEEPVPEGEPWNTLTNLADALQ TFREYGEECYLYKKGLEGGYQLENFLENQKDINPTSWNHITTLMINVHRYLRLDFQTLCLGINFLERYVS CTPTNPDTLTRVGATCLYMAYKVAELRYPLPPKLFLPLFDYRMTPAEMRHLERTILRKLLFRLGVPTIDF FLEHFSLLRLTNQEECSPAQLKRAAKSLTAARGIAALCLNQHQDFYMHKPSLMALCCLNVADKIYSYNNP VKVAPTDYPEHQIEECMEKICHLVSIGHYFLHPLLPGVYPAIFPAFNPPTTRPAATPTNQHLPEGRERTP EVASTSRDTAGSQHLEMAERSSHSQDMEGAGYVLHNTYWPTDPYRQVYMHPYMPTPPYWHPYMPPVSYWH PYMHTLPYLHPYGYIFPY