XB-FEAT-6538722: Difference between revisions
| Line 21: | Line 21: | ||
InterPro domain assessment also support idea that these are hes7 proteins and need renaming. | InterPro domain assessment also support idea that these are hes7 proteins and need renaming. | ||
Revision as of 08:03, 4 April 2024
esr-5
This is the community wiki page for the gene esr-5 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
annotation notes
04.04.2024
The orthology of these Xenopus esr-5 genes is unassigned as of 4.4.24, yet a quick assessment of the protein sequence in EggNog6.0, it matches the Hes7 orthology group (in ~8k proteins and 1165 species).
protein domains
protein seqeunces
the Xtrop and Xlaevis protein sequences are almost identical
>uncharacterized protein LOC100135364 [Xenopus tropicalis] mpdmeysdtfpsrkilkpvvekqrrdrinrsleemrvlllkltgnqklqnpkmekaeilelaviyirnvthmkthdasqwvspaeklylsgfrecldrtedfiseispkaravfldnlqthlqqrlhfptqvglggpgrdheedlmssgnglspimdysisrddlslctppsslssesgspqqwlpasppnqheqapfyiwrpwp
>>XP_018109262.1 PREDICTED: transcription factor HES-7 [Xenopus laevis]
MPDMEYSDTFPSRKILKPVVEKQRRDRINRSLGEMRILLFQLTGNQKLQNPKMEKAEILELAVIYIRNVTRMKTHDPNKWASPAEKMYVSGFRECLDRTEDFISEISPKARAVFLDNLQTHLQQRLLLPQQVGGPGGDHEEDLMSNGSELSPIMDYSISRDELSLCTPSSSLGSESGSPPAWLPSSPPNPHEQPPLYIWRPWP
InterPro domain assessment also support idea that these are hes7 proteins and need renaming.