XB-FEAT-6049135: Difference between revisions
imported>Xenbase gene generator No edit summary |
|||
| Line 1: | Line 1: | ||
= | =''uckl1b''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''uckl1b'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=name changes= | |||
''Xenopus'' gene name and symbol changed from ''uckl1, uridine-cytidine kinase 1-like 1'' to ''uckl1b, uridine-cytidine kinase 1-like 1b'' follwoing orthology assessent and synteny. TRUE UCKL1 orthologs are on Chr 10/9_10L in ''Xenopus'', while these 'b' genes are on chr 5, 5L and 5S. | |||
THe X.trop protein (below) does still hit the UCKL1 homology group, so they are still annotated correctly. | |||
>uridine-cytidine kinase-like 1 [Xenopus tropicalis] | |||
MESGTGEKDGDPGRARARSDSGEDSLETLLTRLPLTPSLSPRKRTTSQSKTEPPLLRTSKRTIYTAGRPPWYNESGTPFKEAFVIGLCGGSASGKTTVANKIIEALDVPWVVLLSMDCFYKILSKEEQDLAARNEYNFDHPDAFDFDLLVNVVRKLKKGKSVKVPVYDFTTHSRRKEWKTIYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVRRLKRDITERGRDIVGVIKQYNKFVKPAFEQYIEPTVQLADIVVPRGGENFVALDLIVQHVHSQLEKRMQRWDMAALASAHQGQPLPDTLSVLLSTPQVRGMHTIIRNKDTNRDEFIFYSKRLMRLLIEHALSFLPLSPVTVETPQGSLYQGKRFHRQRLTGVSILRAGETMEQALMAVCKDIRLGKILIQTNHNTGEPELHYLRLPKEISEDYVILMDSTVSTGAAAMMAIRVLLDHDVQEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNQEFHIIPGIGNFGDRFFGTDAPSDWHESDDFSMDY | |||
Revision as of 21:11, 8 June 2026
uckl1b
This is the community wiki page for the gene uckl1b please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
name changes
Xenopus gene name and symbol changed from uckl1, uridine-cytidine kinase 1-like 1 to uckl1b, uridine-cytidine kinase 1-like 1b follwoing orthology assessent and synteny. TRUE UCKL1 orthologs are on Chr 10/9_10L in Xenopus, while these 'b' genes are on chr 5, 5L and 5S.
THe X.trop protein (below) does still hit the UCKL1 homology group, so they are still annotated correctly.
>uridine-cytidine kinase-like 1 [Xenopus tropicalis] MESGTGEKDGDPGRARARSDSGEDSLETLLTRLPLTPSLSPRKRTTSQSKTEPPLLRTSKRTIYTAGRPPWYNESGTPFKEAFVIGLCGGSASGKTTVANKIIEALDVPWVVLLSMDCFYKILSKEEQDLAARNEYNFDHPDAFDFDLLVNVVRKLKKGKSVKVPVYDFTTHSRRKEWKTIYGANVVIFEGILAFANKELLKLLDMKVFVDTDSDIRLVRRLKRDITERGRDIVGVIKQYNKFVKPAFEQYIEPTVQLADIVVPRGGENFVALDLIVQHVHSQLEKRMQRWDMAALASAHQGQPLPDTLSVLLSTPQVRGMHTIIRNKDTNRDEFIFYSKRLMRLLIEHALSFLPLSPVTVETPQGSLYQGKRFHRQRLTGVSILRAGETMEQALMAVCKDIRLGKILIQTNHNTGEPELHYLRLPKEISEDYVILMDSTVSTGAAAMMAIRVLLDHDVQEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNQEFHIIPGIGNFGDRFFGTDAPSDWHESDDFSMDY