XB-FEAT-982798
mgc69473
This is the community wiki page for the gene mgc69473 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
26APRIL2023 gene symbol changed from mgc69473 to rbm43-like to reflect provisional orthology group.
protein
uncharacterized protein LOC407914 [Xenopus tropicalis]
NCBI Reference Sequence: NP_001001233.1
>NP_001001233.1 uncharacterized protein LOC407914 [Xenopus tropicalis]
MALELEENLHSEEEEEEDEEEEEEEEEEEEEEEEEEEEEGGGMQTRSPSKRNKGGASSSSSSSGSAKKKK
KKKNQPGRYSQLVVDTIRKLGERNGSSLAKIYSEAKKVAWFDQQNGRTYLKYSIKALVQNDTLLQVKGVG
ANGSFRLNKKKLEGLPFEKKAAPPAKPPSKRRAPAASSSPAKSHKKAKPTAEKEKPQKSSVKAPSKSHKK
GAKGKKVKKGAKPSVPKVPKSKKA
orthology
DIOPT/EggNog matches this protein ( omitting teh long string of EEEEEs) matching >600 proteins from >200 species including reptiles and mammals. matches to Mouse and rat, below, show that this is likely a histone but the gene symbol to use here is unclear:
Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c
Rattus norvegicus 9 seqs 10116.ENSRNOP00000019696, 10116.ENSRNOP00000065338, 10116.ENSRNOP00000023054, 10116.ENSRNOP00000006172, 10116.ENSRNOP00000048205, 10116.ENSRNOP00000032882, 10116.ENSRNOP00000066786, 10116.ENSRNOP00000024304, 10116.ENSRNOP00000053053 Hp1bp3, LOC684828, Hist1h1a, Rbm43, H1foo, H1fx, Hist1h1d, Hist1h1b, H1f0
Gene name wise, we might goin with 'rbm43-like' for now for simplicity.