XB-FEAT-5822256

loc100124990

This is the community wiki page for the gene loc100124990 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

16MAY2023

Xenopus gene symbol changed from XB5822256 [provisional:cdc42ep2] to cdc42ep2l

Xenopus gene name changed from provisonal orthology of CDC42 effector protein 2 to CDC42 effector protein 2 like

synteny and orthology

Synteny is broken, thus it does not confirm this gene as the ortholog of CDC42EP2

However DIOPT/EggNog analysis of LOC100124990 protein [Xenopus tropicalis] matches 22 proteins in 22 species as cdc42 effector, and 81 proteins in 81 species as cdc42ep2, including Xenopus (Silurana) ENSXETP00000050314 cdc42ep2

protein sequence used in DIOPT anlaysis

>AAI35992.1 LOC100124990 protein [Xenopus tropicalis]

MPAKTPIYLKTSTPKRGKKPKLRDVLSSEMISPPLGDFRHSAHIGLDGEGDMFGELSFLQGKYDLLPSMG RKFTIHSTDTSLDEEYHSDAGHASYRPYLKNAVSLPAFSAPHSKERAPPKPPRLHLEETPSQRSMSISYG ERCFSRDENVSFASIPLDQESSNLEVYDSSSEGSINEDGAQSLGSTSDPMQKKQRQPNHPGTRHSKIRVPLWA

Based on the DIOPT analysis, this gene can be provisionally called cdc42ep2l with a degree of confidence.