XB-FEAT-940377
unnamed
This is the community wiki page for the gene unnamed please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
synteny
long strings CYCLIN-O B and B-like protein coding genes are duplicated in Xenopus tropicalis, but not in similar syntenic regions in mouse or human.
Xtr.Chr8: LOC100486764(phka2l)< LOC108648359(unch)< LOC116406532(ccnopbl)> LOC116406533(ccnopbl)>XB940377> LOC108648361(ncRNA)< LOC116406431(ccnopbl)> phka1< LOCLOC101733971(ccnopb)> LOC101733918(ccnopb)> LOC116406535(ccnopbl)> LOC116406536(ccnopbl)> XB994497(ccnopbl)> LOC116406534(ccnopbl)> cldn2> frmpd3>
Human CHRX: TBC1D8B> RIPPL1< CLDN2> MORC4<
Mouse chrX: tbc1d8b> ripply1< cldn2> morc4< rbm41<
nomencatrue changes
This gene is definately a cyclin, and most likely one of many cyclin o, b or cyclin o, b like genes.
Thus we are provisonally updating its name from unnamed/ XB940377 to cyclin-o- b gene 4, ccnob.4 as it is the 4th when counting left to right) in this string of 12 duplicated genes.
orthology and homology groups
22MAY2023
Using DIOPT/EGGNOG tool to assess the likely identity of this gene, it matches >2400 proteins from >400 species.
The NCBI refSeq Protein accession for thisX. tropicalis gene matches 17 sequences for X.tropicalis in ENSMBL dtabse:
17 seqs 8364.ENSXETP00000057169, 8364.ENSXETP00000015664, 8364.ENSXETP00000048888, 8364.ENSXETP00000021658, 8364.ENSXETP00000062384, 8364.ENSXETP00000023728, 8364.ENSXETP00000064034, 8364.ENSXETP00000063506, 8364.ENSXETP00000014000, 8364.ENSXETP00000023716, 8364.ENSXETP00000035701, 8364.ENSXETP00000009033, 8364.ENSXETP00000001012, 8364.ENSXETP00000034708, 8364.ENSXETP00000061262, 8364.ENSXETP00000017352, 8364.ENSXETP00000058282 ccni, 8364.ENSXETP00000015664, ccnb3, 8364.ENSXETP00000021658, 8364.ENSXETP00000062384, ccnb2, 8364.ENSXETP00000064034, 8364.ENSXETP00000063506, ccng2, LOC394448, ccnb1.2, ccni2, ccnb1, cntd2, 8364.ENSXETP00000061262, ccng1, ccno
It also matches these Chicken/Gallus proteins: 7 seqs 9031.ENSGALP00000018658, 9031.ENSGALP00000039111, 9031.ENSGALP00000002633, 9031.ENSGALP00000016827, 9031.ENSGALP00000041819, 9031.ENSGALP00000041991, 9031.ENSGALP00000006605 CCNI, CCNI2, CCNG1, CCNG2, CCNB3, CCNO, CCNB2.
and these proteinsin Mouse and rat.
Mus musculus 4 seqs 10090.ENSMUSP00000029270, 10090.ENSMUSP00000058111, 10090.ENSMUSP00000111048, 10090.ENSMUSP00000029368 Ccna2, Ccnjl, Ccnf, Ccna1
Rattus norvegicus 5 seqs 10116.ENSRNOP00000021156, 10116.ENSRNOP00000060445, 10116.ENSRNOP00000039931, 10116.ENSRNOP00000005171, 10116.ENSRNOP00000039779 Ccna2, Ccnf, Ccna1, Ccnjl, Apob
note that:
Ccna2, is cylin A2
Ccnf, is cyclin F
Ccna1,is cylin A1
Ccng1, i s cyclin G1
Ccno is cyclin O
SO we can confidently say this is another cyclin gene. The cyclins consist of 8 classes of cell cycle regulators, designated A-G, also Q & S in invertebates, that regulate cyclin dependent kinases (CDKs), so further phylogenetic assessment is required to classify this protein.
protein accession
uncharacterized protein LOC100127658 [Xenopus tropicalis]
NCBI Reference Sequence: NP_001106473.2
>NP_001106473.2 uncharacterized protein LOC100127658 [Xenopus tropicalis]
MEILSVGMRKRRREEEEEQEEEIISPGCSPEFKRAKPQGDLRGTSTPTAEEPVPEGEPWNTLTNLADALQ TFREYGEECYLYKKGLEGGYQLENFLENQKDINPTSWNHITTLMINVHRYLRLDFQTLCLGINFLERYVS CTPTNPDTLTRVGATCLYMAYKVAELRYPLPPKLFLPLFDYRMTPAEMRHLERTILRKLLFRLGVPTIDF FLEHFSLLRLTNQEECSPAQLKRAAKSLTAARGIAALCLNQHQDFYMHKPSLMALCCLNVADKIYSYNNP VKVAPTDYPEHQIEECMEKICHLVSIGHYFLHPLLPGVYPAIFPAFNPPTTRPAATPTNQHLPEGRERTP EVASTSRDTAGSQHLEMAERSSHSQDMEGAGYVLHNTYWPTDPYRQVYMHPYMPTPPYWHPYMPPVSYWH PYMHTLPYLHPYGYIFPY