All public logs

Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

• 14:10, 13 July 2023 Christina talk contribs created page XB-FEAT-29092170 (Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
• 14:06, 13 July 2023 Christina talk contribs created page XB-FEAT-29091846 (Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is...")
• 13:54, 13 July 2023 Christina talk contribs created page XB-FEAT-29079470 (Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a...")
• 13:49, 13 July 2023 Christina talk contribs created page XB-FEAT-29091842 (Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
• 13:38, 13 July 2023 Christina talk contribs created page XB-FEAT-29085518 (Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
• 13:28, 13 July 2023 Christina talk contribs created page XB-FEAT-29089986 (Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is...")
• 13:14, 13 July 2023 Christina talk contribs created page XB-FEAT-29098998 (Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL...")
• 12:55, 13 July 2023 Christina talk contribs created page XB-FEAT-29098938 (Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath...")
• 12:42, 13 July 2023 Christina talk contribs created page XB-FEAT-29098762 (Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t...")
• 12:22, 13 July 2023 Christina talk contribs created page XB-FEAT-29098926 (Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m...")
• 13:58, 11 July 2023 Xenbase talk contribs changed group membership for VG from (none) to administrator, interface administrator and bureaucrat
• 08:32, 6 July 2023 User account VG talk contribs was created by Xenbase talk contribs and password was sent by email
• 10:10, 21 June 2023 Christina talk contribs created page XB-FEAT-29087790 (Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH...")
• 10:00, 21 June 2023 Christina talk contribs created page XB-FEAT-29077586 (Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF...")
• 09:55, 21 June 2023 Christina talk contribs created page XB-FEAT-29097482 (Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc...")
• 09:38, 21 June 2023 Christina talk contribs created page XB-FEAT-29099066 (Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase....")
• 09:26, 21 June 2023 Christina talk contribs created page XB-FEAT-29091390 (Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''...")
• 15:44, 16 June 2023 Christina talk contribs created page XB-FEAT-22063241 (Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte...")
• 07:11, 16 June 2023 Christina talk contribs created page XB-FEAT-29093310 (Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher...")
• 10:14, 15 June 2023 Christina talk contribs created page XB-FEAT-29077890 (Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro...")
• 13:45, 8 June 2023 Christina talk contribs created page XB-FEAT-22068128 (Created page with "=''spmip4''= his is the community wiki page for the gene ''spmip4'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
• 12:05, 8 June 2023 Christina talk contribs created page XB-FEAT-29071333 (Created page with "=''atrx2''=")
• 09:07, 8 June 2023 Christina talk contribs created page XB-FEAT-22065335 (Created page with "=''msantdl.2 ''= This is the community wiki page for the gene ''msantdl.2 '' please feel free to add any information that is relevant to this gene that is not already capture...")
• 10:56, 7 June 2023 Christina talk contribs created page XB-FEAT-22068619 (Created page with "=''XB22068619 ''= This is the community wiki page for the gene ''XB22068619 '' please feel free to add any information that is relevant to this gene that is not already captu...")
• 10:31, 7 June 2023 Christina talk contribs created page XB-FEAT-25874688 (Created page with "=''trat1l''= This is the community wiki page for the gene ''trat1l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
• 10:14, 7 June 2023 Christina talk contribs created page XB-FEAT-22069556 (Created page with "=nomenclature updates= 05 JUNE 2023 ''Xenopus'' gene symbol and gene name has changed for genepage ID: 22069550 From ''mettl7a.3, methyltransferase like 7A, gene 3'' to ''tm...")
• 07:30, 7 June 2023 Christina talk contribs created page XB-FEAT-6464249 (Created page with "=''tektl1''= This is the community wiki page for the gene ''tektl1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
• 11:53, 6 June 2023 Christina talk contribs created page XB-FEAT-6469233 (Created page with "=nomenclature updates= 05JUNE 2023 Human name has changed for Entrez Gene: 10086. From HERV-H LTR-associating 1 to HHLA1 neighbor of OC90")
• 10:56, 6 June 2023 Christina talk contribs created page XB-FEAT-22065730 (Created page with "=''ocm4.10''= This is the community wiki page for the gene ''ocm4.10'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
• 10:54, 6 June 2023 Christina talk contribs created page XB-FEAT-22065778 (Created page with "=''ocm4.9''= This is the community wiki page for the gene ''ocm4.9'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
• 10:52, 6 June 2023 Christina talk contribs created page XB-FEAT-22065774 (Created page with "=''ocm4.8''= This is the community wiki page for the gene ''ocm4.8'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
• 10:51, 6 June 2023 Christina talk contribs created page XB-FEAT-22065770 (Created page with "=''ocm4.7''= This is the community wiki page for the gene ''ocm4.7'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
• 10:45, 6 June 2023 Christina talk contribs created page XB-FEAT-22065766 (Created page with "=o''cm4.6''= This is the community wiki page for the gene ''ocm4.6'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
• 11:33, 1 June 2023 Christina talk contribs created page XB-FEAT-22041759 (Created page with "=''znf84l''= This is the Xenbase community wiki page for ''Xenopus'' ''znf84l'' genes. Please feel free to add any information here relevant to ''znf84l'' that is not captured...")
• 13:03, 31 May 2023 Christina talk contribs created page XB-FEAT-18006544 (Created page with "=''lrrn1l''= This is teh community wiki page for the ''Xenopus '' ''lrrn1l'' genes. Please feel free to record here any relevant information about ''lrrn1l'' that is not recor...")
• 09:43, 31 May 2023 Christina talk contribs created page XB-FEAT-18006559 (Created page with "=''atp12al''= This is the community wiki page for ''atp12al''. Please fee free to add here any relevant information about this gene that is not represented elsewhere on Xenbas...")
• 11:48, 30 May 2023 Christina talk contribs created page XB-FEAT-25874530 (haus3)
• 13:51, 26 May 2023 Christina talk contribs created page XB-FEAT-6462368 (Created page with "= ''c8h8orf48''= This is the community wiki page for the ''Xenopus c8h8orf48'' genes. Please feel free to record here any relevant information that is not recorded elsewhere o...")
• 14:27, 25 May 2023 Christina talk contribs created page XB-FEAT-22068108 (Created page with " =orthology inference from protein sequence= the Xtrop protein accession XP_031756970.1 matches C3orf62 genes in DIOPT/EggNog Orthologs group, with 67 proteins in 67 specie...")
• 10:46, 24 May 2023 Christina talk contribs created page XB-FEAT-6461374 (Created page with "=''c6h5orf63''= This is the Xenbase wiki page for the ''Xenopus'' ''c6h5orf63'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase....")
• 10:36, 24 May 2023 Christina talk contribs created page XB-FEAT-25919034 (Created page with "=’’gene symbol’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘symbol’’ genes. Please add any relevant information here that is not represented e...")
• 06:24, 24 May 2023 Christina talk contribs created page XB-FEAT-25874677 (Created page with " =’’il9’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘il9’’ genes. Please add any relevant information here that is not represented elsewhere o...")
• 08:19, 23 May 2023 Christina talk contribs created page XB-FEAT-22164440 (Created page with "=''prfprl2''= This is the Xenbase wiki page for the ''Xenopus prfprl2'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase. =nomen...")
• 06:26, 23 May 2023 Christina talk contribs created page XB-FEAT-22250296 (Created page with "=''mt-atp8''= This is the Xenbase wiki for ''Xenopus'' ''mt-atp8'' genes. Please feel free to add any information relevant to these genes that is not captured elsewhere on Xe...")
• 13:08, 17 May 2023 Christina talk contribs created page XB-FEAT-18386060 (Created page with "=''cyp27a1.3''=")
• 08:24, 16 May 2023 Christina talk contribs created page XB-FEAT-22069202 (Created page with "=nomenclature changes= 16MAY2023 Xenopus gene was renamed, changing from ''sprr3, small proline rich protein 3'' to ''vgf , VGF nerve growth factor inducible''.")
• 07:51, 16 May 2023 Christina talk contribs created page XB-FEAT-29072295 (Created page with "=tmem86al= This is the community wiki page for teh Xenopus ''tmem86al'' genes. Please feel free to enter here any information relevent to these genes that is not found elsewhe...")
• 07:22, 16 May 2023 Christina talk contribs created page NH-3 (Created page with "==Description== NH-3 is an orally active, reversible thyroid hormone receptor (THR) antagonist with an IC50 of 55 nM. NH-3, a derivative of the selective thyromi-metic GC-1,...")
• 11:18, 9 May 2023 Christina talk contribs created page XB-FEAT-6462861 (Created page with "=''il17rel''= thsi is the community wiki page for the ''Xenopus'' ''il17rel'' genes. Please post here any relevant information about these genes that is not found elsewhere o...")
• 10:18, 9 May 2023 Christina talk contribs created page XB-FEAT-6462903 (Created page with "=''il17rc''= This is the community wiki page for the ''Xenopus'' "il17rc'' genes. Please record here any relevant information about these genes that is not recorded elsewhere...")