XB-FEAT-22166267

From XenWiki
Revision as of 12:54, 4 January 2023 by Christina (talk | contribs) (→‎wdr88l)
Jump to navigation Jump to search

wdr88l

This is the community wiki page for the gene wdr88l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenlcature changes

04JAN2023 gene name changed from loc100145065 to WD repeat domain 88 like

gene symbol changed from XB22166267 to wdr88l

both gene name and symbols are given provisional staus tags, as teh identity is uncertain.

Protein sequence

LSSKVAARKFPSVPSQETPSRMDQELTDGSVGRAWTPQETQAMLDLIRDLGLGPALTRKGYQNWDVFERLQVLLSHCRVRASSAEIKAQW QALKMKFWRLKRFVGLAPLVAITADFPFYQQMEQLLEPQKRMEICSREADSTIQESGRPTSSLSDSPSDEDMTDDASIPEVHHEQEPAIN NGGNLHPENVQEAAPQDGAAIRNPHLAPEALADLEPEPIRLLQTTMGQLVEGMAQLVQTLNRVCGVQEQISIQLGYFCSLLPKFPIQMGS GRPRNQEGGKCPEKKPVVHGPRNSRGLRRSLRIKKFAARYSS

This partial sequence contains a Myb/SANT-like DNA-binding domain, and when entered into the DIOPT EggNogg tool, is close homolog to Xenopus wdr88 gene, and 2 other sequemces ( weak evidence at best). Thus the gene is provisonally named wdr88 like