XB-FEAT-5934217

From XenWiki
Revision as of 10:32, 26 April 2023 by Christina (talk | contribs) (→‎fdx1.2)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

fdx1l.2

This is the community wiki page for the gene fdx1l.2 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

orthology/homology analysis

DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485

>XP_002936827.1 adrenodoxin [Xenopus tropicalis]

MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ

nomenclature changes

Based on above analysis, gene symbol updated, changing from fdx1b to fdx1l.2, feradoxin 1 like gene 2