XB-FEAT-982798
rbm43l
This is the community wiki page for the gene rbm43l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
nomenclature changes
26APRIL2023 gene symbol changed from mgc69473 to rbm43-like to reflect provisional orthology group.
protein
uncharacterized protein LOC407914 [Xenopus tropicalis]
NCBI Reference Sequence: NP_001001233.1
>NP_001001233.1 uncharacterized protein LOC407914 [Xenopus tropicalis]
MALELEENLHSEEEEEEDEEEEEEEEEEEEEEEEEEEEEGGGMQTRSPSKRNKGGASSSSSSSGSAKKKK
KKKNQPGRYSQLVVDTIRKLGERNGSSLAKIYSEAKKVAWFDQQNGRTYLKYSIKALVQNDTLLQVKGVG
ANGSFRLNKKKLEGLPFEKKAAPPAKPPSKRRAPAASSSPAKSHKKAKPTAEKEKPQKSSVKAPSKSHKK
GAKGKKVKKGAKPSVPKVPKSKKA
orthology
DIOPT/EggNog matches this protein ( omitting the long string of EEEEEs) matching >600 proteins from >200 species including reptiles and mammals.
Matches to Mouseand rat, below, show that this is likely a 'histone 1 ' but the gene symbol to be use here is unclear:
Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c
Rattus norvegicus 9 seqs 10116.ENSRNOP00000019696, 10116.ENSRNOP00000065338, 10116.ENSRNOP00000023054, 10116.ENSRNOP00000006172, 10116.ENSRNOP00000048205, 10116.ENSRNOP00000032882, 10116.ENSRNOP00000066786, 10116.ENSRNOP00000024304, 10116.ENSRNOP00000053053 Hp1bp3, LOC684828, Hist1h1a, Rbm43, H1foo, H1fx, Hist1h1d, Hist1h1b, H1f0
Gene name/symbol wise, we might goin with 'rbm43-like' for now for simplicity. Further Ana;lsyis would be necessary to name more precisely.